BLASTX nr result
ID: Gardenia21_contig00025767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00025767 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12714.1| unnamed protein product [Coffea canephora] 57 7e-06 >emb|CDP12714.1| unnamed protein product [Coffea canephora] Length = 685 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 3 NCGLTSRYSFKAVKWNFSSGTDIAAILVDDVLE 101 NC L SRYSF+AVKWNF+SGT IAAI DDVLE Sbjct: 653 NCALISRYSFRAVKWNFNSGTGIAAICSDDVLE 685