BLASTX nr result
ID: Gardenia21_contig00024960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024960 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01016.1| unnamed protein product [Coffea canephora] 64 6e-08 >emb|CDP01016.1| unnamed protein product [Coffea canephora] Length = 340 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSKQLGDFLQEQQEPFILEAYLLERGYSSSSV 2 MSKQLGDFLQEQQEPFILE YLLERGYSSSS+ Sbjct: 1 MSKQLGDFLQEQQEPFILEVYLLERGYSSSSI 32