BLASTX nr result
ID: Gardenia21_contig00024714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024714 (447 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526374.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 >ref|XP_002526374.1| conserved hypothetical protein [Ricinus communis] gi|223534333|gb|EEF36045.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/71 (46%), Positives = 43/71 (60%) Frame = -1 Query: 381 MESVQKILATLGRQCYAWFCLGVVLVSVVIAHFALPEAGDHQKPLTESSKGDQERARTKR 202 ME+VQ +L LGRQCYA CLG++LV V IA + + G+ + RT+R Sbjct: 1 METVQGLLGRLGRQCYAVLCLGMILVIVSIARYVGDDGGE---------MISDPKERTRR 51 Query: 201 RLRALHGAPLR 169 RLRA+HG PLR Sbjct: 52 RLRAIHGPPLR 62