BLASTX nr result
ID: Gardenia21_contig00024488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024488 (918 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003620942.1| photosystem I assembly protein ycf3 [Medicag... 127 9e-27 gb|ERN02875.1| hypothetical protein AMTR_s00334p00015220 [Ambore... 126 3e-26 ref|XP_003599571.2| photosystem I assembly protein ycf3 [Medicag... 124 1e-25 pir||A05190 hypothetical protein 77 - common tobacco chloroplast... 117 2e-23 ref|YP_817483.1| photosystem I assembly protein ycf3 [Coffea ara... 109 3e-21 ref|XP_013443688.1| 30S ribosomal protein S4, putative [Medicago... 103 2e-20 ref|YP_009172278.1| hypothetical chloroplast RF34 (chloroplast) ... 105 4e-20 gb|AIS35684.1| hypothetical chloroplast RF34 (chloroplast) [Mese... 105 4e-20 ref|YP_009143640.1| photosystem I assembly protein Ycf3 (chlorop... 105 4e-20 gb|AJP62111.1| photosystem I assembly protein Ycf3 (chloroplast)... 105 4e-20 ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) ... 105 4e-20 ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chlorop... 105 4e-20 ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulg... 105 4e-20 ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chlorop... 105 4e-20 ref|YP_009000107.1| hypothetical chloroplast RF34 (chloroplast) ... 105 4e-20 gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aem... 105 4e-20 ref|YP_004376422.1| Ycf3 protein [Olea europaea subsp. europaea]... 105 4e-20 ref|YP_009144114.1| photosystem I assembly protein Ycf3 (chlorop... 105 5e-20 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 105 5e-20 ref|NP_054934.1| photosystem I assembly protein Ycf3 [Spinacia o... 105 6e-20 >ref|XP_003620942.1| photosystem I assembly protein ycf3 [Medicago truncatula] gi|355495957|gb|AES77160.1| photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 127 bits (320), Expect = 9e-27 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -3 Query: 808 ETLKYGSKGRD*PTYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWL 629 ETLKYGSKGR+ TYSDRGEQAIRQGDSEIAE+WFDQAAEYWKQAI+LTPGNYIEA NWL Sbjct: 4 ETLKYGSKGRNLLTYSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWL 63 Query: 628 KITGRF 611 KITGRF Sbjct: 64 KITGRF 69 >gb|ERN02875.1| hypothetical protein AMTR_s00334p00015220 [Amborella trichopoda] Length = 70 Score = 126 bits (316), Expect = 3e-26 Identities = 60/69 (86%), Positives = 63/69 (91%) Frame = -3 Query: 817 MR*ETLKYGSKGRD*PTYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAH 638 MR ETLKYGSKGR+ YSDRGEQAIRQGDSEIAEAWFDQAAEYWKQA++LTPGNYIEA Sbjct: 1 MRSETLKYGSKGRNLSAYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQALALTPGNYIEAQ 60 Query: 637 NWLKITGRF 611 NWLKIT RF Sbjct: 61 NWLKITRRF 69 >ref|XP_003599571.2| photosystem I assembly protein ycf3 [Medicago truncatula] gi|657392475|gb|AES69822.2| photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 124 bits (311), Expect = 1e-25 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -3 Query: 808 ETLKYGSKGRD*PTYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWL 629 ETLKYGSKGR+ T SDRGEQAIRQGDSEIAE+WFDQAAEYWKQAI+LTPGNYIEA NWL Sbjct: 4 ETLKYGSKGRNLLTNSDRGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWL 63 Query: 628 KITGRF 611 KITGRF Sbjct: 64 KITGRF 69 >pir||A05190 hypothetical protein 77 - common tobacco chloroplast gi|225199|prf||1211235AD ORF 77 Length = 77 Score = 117 bits (292), Expect = 2e-23 Identities = 62/77 (80%), Positives = 66/77 (85%) Frame = +2 Query: 638 MRFNIITRSK*YSLFPILSGLIEPSLRYFRISLSNGLFSTVGIGRSIPSLRTVLESFLPH 817 MRFNIIT SK YSLFPILSGLIEPSL FRISL NGLFS GIG SIPSLRTVLE+FLPH Sbjct: 1 MRFNIITGSKRYSLFPILSGLIEPSLCNFRISLLNGLFSPAGIGSSIPSLRTVLENFLPH 60 Query: 818 TAQQSILLVCRFNLLYL 868 TAQQSILLV F+L ++ Sbjct: 61 TAQQSILLVSHFDLYHI 77 >ref|YP_817483.1| photosystem I assembly protein ycf3 [Coffea arabica] gi|122153622|sp|A0A336.1|YCF3_COFAR RecName: Full=Photosystem I assembly protein Ycf3 gi|116242165|gb|ABJ89680.1| photosystem I assembly protein ycf3 [Coffea arabica] Length = 168 Score = 109 bits (272), Expect = 3e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRFG 608 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRFG Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRFG 168 >ref|XP_013443688.1| 30S ribosomal protein S4, putative [Medicago truncatula] gi|657371732|gb|KEH17713.1| 30S ribosomal protein S4, putative [Medicago truncatula] Length = 336 Score = 103 bits (256), Expect(2) = 2e-20 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = -3 Query: 781 RD*PTYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 R+ YSDRGEQAI +GDSEIAEAWFDQAAEYWKQAI+LTPGNYIEA NWLKIT RF Sbjct: 277 REGTAYSDRGEQAILEGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITKRF 333 Score = 24.3 bits (51), Expect(2) = 2e-20 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 810 RKLSSTVLREG 778 RKLSSTVLREG Sbjct: 269 RKLSSTVLREG 279 >ref|YP_009172278.1| hypothetical chloroplast RF34 (chloroplast) [Colobanthus quitensis] gi|930616905|gb|ALF99642.1| hypothetical chloroplast RF34 (chloroplast) [Colobanthus quitensis] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >gb|AIS35684.1| hypothetical chloroplast RF34 (chloroplast) [Mesembryanthemum crystallinum] Length = 169 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 120 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 168 >ref|YP_009143640.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia brachiata] gi|836613930|ref|YP_009143724.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia europaea] gi|836642804|ref|YP_009143808.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia bigelovii] gi|648933084|gb|AIC37025.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia brachiata] gi|648933169|gb|AIC37109.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia europaea] gi|648933254|gb|AIC37193.1| photosystem I assembly protein Ycf3 (chloroplast) [Salicornia bigelovii] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >gb|AJP62111.1| photosystem I assembly protein Ycf3 (chloroplast) [Dianthus longicalyx] Length = 169 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 120 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 168 >ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) (chloroplast) [Agrostemma githago] gi|576312302|ref|YP_009000186.1| hypothetical chloroplast RF34 (chloroplast) (chloroplast) [Silene paradoxa] gi|555944022|gb|AGZ17926.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|555944275|gb|AGZ18176.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438687605|emb|CCP47131.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688289|emb|CCP47220.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688413|emb|CCP47309.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] Length = 169 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 120 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRF 168 >ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulgaris] gi|374249789|ref|YP_005089418.1| ycf3 gene product (chloroplast) [Silene noctiflora] gi|374249878|ref|YP_005089506.1| ycf3 gene product (chloroplast) [Silene conica] gi|374249951|ref|YP_005089578.1| ycf3 gene product (chloroplast) [Silene latifolia] gi|575925640|ref|YP_009000025.1| hypothetical chloroplast RF34 (chloroplast) (chloroplast) [Silene conoidea] gi|329755449|gb|AEC04013.1| hypothetical chloroplast RF34 (chloroplast) [Silene conica] gi|329755522|gb|AEC04085.1| hypothetical chloroplast RF34 (chloroplast) [Silene latifolia] gi|329755606|gb|AEC04168.1| hypothetical chloroplast RF34 (chloroplast) [Silene noctiflora] gi|329755687|gb|AEC04248.1| hypothetical chloroplast RF34 (chloroplast) [Silene vulgaris] gi|555944112|gb|AGZ18015.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] gi|916444559|gb|AKZ24475.1| photosystem I assembly protein Ycf3 (plastid) [Silene vulgaris] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] gi|363413086|gb|ADA69927.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] Length = 167 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 118 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRF 166 >ref|YP_009000107.1| hypothetical chloroplast RF34 (chloroplast) (chloroplast) [Silene chalcedonica] gi|166235536|gb|ABY85451.1| ycf3 protein [Silene chalcedonica] gi|555944195|gb|AGZ18097.1| hypothetical chloroplast RF34 (chloroplast) [Silene chalcedonica] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >gb|ABU85615.1| photosystem I assembly protein ycf3 [Scaevola aemula] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 167 >ref|YP_004376422.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334700283|ref|YP_004563782.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334701620|ref|YP_004564005.1| Ycf3 protein [Olea woodiana subsp. woodiana] gi|334701889|ref|YP_004564498.1| Ycf3 protein [Olea europaea subsp. maroccana] gi|404474412|ref|YP_006665781.1| hypothetical chloroplast RF34 (chloroplast) [Elodea canadensis] gi|731971832|ref|YP_009110603.1| Ycf3 protein (chloroplast) [Hesperelaea palmeri] gi|110456718|gb|ABG74821.1| YCF3 protein [Jasminum subhumile] gi|290488948|gb|ADD30858.1| putative RF3 protein (chloroplast) [Ilex cornuta] gi|291059254|gb|ADD72090.1| hypothetical chloroplast RF34 (chloroplast) [Olea europaea] gi|328795434|emb|CBR30316.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084402|emb|CBR23831.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334084488|emb|CBR24622.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084574|emb|CBR30407.1| Ycf3 protein [Olea europaea subsp. europaea] gi|334084660|emb|CBS29351.1| Ycf3 protein [Olea woodiana subsp. woodiana] gi|334084865|emb|CBS29241.1| Ycf3 protein [Olea europaea subsp. maroccana] gi|334084951|emb|CBJ04299.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|334085037|emb|CBR23739.1| Ycf3 protein [Olea europaea subsp. cuspidata] gi|374094597|gb|AEY84653.1| hypothetical chloroplast RF34 (chloroplast) [Elodea canadensis] gi|510934405|emb|CCQ09103.1| Ycf3 protein (chloroplast) [Olea europaea subsp. europaea] gi|725798287|emb|CED79763.1| Ycf3 protein (chloroplast) [Hesperelaea palmeri] Length = 168 Score = 105 bits (263), Expect = 4e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWLKITGRF 167 >ref|YP_009144114.1| photosystem I assembly protein Ycf3 (chloroplast) [Wollemia nobilis] gi|814936740|gb|AKE36587.1| photosystem I assembly protein Ycf3 (chloroplast) [Wollemia nobilis] Length = 180 Score = 105 bits (262), Expect = 5e-20 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = -3 Query: 769 TYSDRGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRFG 608 TY DRGEQAIRQGD EIAEAWFDQAAEYWKQAI+L P NYIEA NWLKITGRFG Sbjct: 126 TYPDRGEQAIRQGDPEIAEAWFDQAAEYWKQAIALAPSNYIEAQNWLKITGRFG 179 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 105 bits (262), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSE+AEAWFDQAAEYWKQAI+LTPGNYIEAHNWLKITGRF Sbjct: 168 RGEQAIRQGDSEVAEAWFDQAAEYWKQAITLTPGNYIEAHNWLKITGRF 216 >ref|NP_054934.1| photosystem I assembly protein Ycf3 [Spinacia oleracea] gi|18203267|sp|Q9M3M5.1|YCF3_SPIOL RecName: Full=Photosystem I assembly protein Ycf3 gi|7636107|emb|CAB88727.1| ycf3 protein (chloroplast) [Spinacia oleracea] Length = 165 Score = 105 bits (261), Expect = 6e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 757 RGEQAIRQGDSEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWLKITGRF 611 RGEQAIRQGDSEIAEAWFDQAAEYWKQA++LTPGNYIEAHNWLKITGRF Sbjct: 116 RGEQAIRQGDSEIAEAWFDQAAEYWKQALTLTPGNYIEAHNWLKITGRF 164