BLASTX nr result
ID: Gardenia21_contig00024461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024461 (583 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08215.1| unnamed protein product [Coffea canephora] 68 4e-09 >emb|CDP08215.1| unnamed protein product [Coffea canephora] Length = 579 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 580 SSGKWEEAKRLREAIEERGFNKVPGCSWTKPAEA 479 SSGKW+EA RLREAIEER FNKVPGCSW KPAEA Sbjct: 546 SSGKWDEATRLREAIEERSFNKVPGCSWIKPAEA 579