BLASTX nr result
ID: Gardenia21_contig00024210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024210 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10062.1| unnamed protein product [Coffea canephora] 76 9e-12 >emb|CDP10062.1| unnamed protein product [Coffea canephora] Length = 584 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/69 (50%), Positives = 46/69 (66%) Frame = +2 Query: 50 RYFVERCLGHPMVDFDVREDSNTRGKEITCEACTDPIVSACCKRVNSGYFLHVACALLRE 229 R+ + GHP+V DVRE + RGKEITCEACT+PIVS C KRV S +FLH C ++++ Sbjct: 275 RFIMRAICGHPVVRLDVREHATARGKEITCEACTEPIVSTCYKRVTSNHFLHDIC-VMQQ 333 Query: 230 TTRFSSHGP 256 T + P Sbjct: 334 TALYHPPNP 342