BLASTX nr result
ID: Gardenia21_contig00024125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024125 (384 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11683.1| unnamed protein product [Coffea canephora] 82 2e-13 >emb|CDP11683.1| unnamed protein product [Coffea canephora] Length = 526 Score = 81.6 bits (200), Expect = 2e-13 Identities = 42/66 (63%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = -3 Query: 193 MGYEND--LDEDGEPLMDYDDDFNSXXXXXXXXXXXXXXXXXXXXDGWNRRERSPPTPVH 20 MGYEND DEDGEPLMDYDDD NS DGWNRRERSPPTPVH Sbjct: 1 MGYENDPYRDEDGEPLMDYDDDVNSDHEQDQQQHHHLLDEDEENDDGWNRRERSPPTPVH 60 Query: 19 DEYKSK 2 DEYKSK Sbjct: 61 DEYKSK 66