BLASTX nr result
ID: Gardenia21_contig00024064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00024064 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97807.1| unnamed protein product [Coffea canephora] 88 3e-15 >emb|CDO97807.1| unnamed protein product [Coffea canephora] Length = 831 Score = 87.8 bits (216), Expect = 3e-15 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -2 Query: 138 MGSDSYRQRDQLPCMNLQQNSSKAAGYMHKFKLYETLSNFYMIGWN 1 MGSDSYRQ+DQLP MNLQQN SKAAGYMHKFKLYET S FYMIGW+ Sbjct: 1 MGSDSYRQQDQLPWMNLQQNYSKAAGYMHKFKLYETFSKFYMIGWD 46