BLASTX nr result
ID: Gardenia21_contig00023796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00023796 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00705.1| unnamed protein product [Coffea canephora] 102 1e-19 >emb|CDP00705.1| unnamed protein product [Coffea canephora] Length = 754 Score = 102 bits (254), Expect = 1e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 162 MHVILISVFIQQVLFFIRFMMTLYARASKSIISKNFLKLEVKLLFFASIHHSHC 1 MHVILISVFI+QVLFFIRFMMTLYARASKSIISKNFLK+EVKLLFFASIH SHC Sbjct: 1 MHVILISVFIRQVLFFIRFMMTLYARASKSIISKNFLKVEVKLLFFASIHQSHC 54