BLASTX nr result
ID: Gardenia21_contig00023645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00023645 (442 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18198.1| unnamed protein product [Coffea canephora] 86 8e-15 >emb|CDP18198.1| unnamed protein product [Coffea canephora] Length = 180 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +3 Query: 3 RNGNVGWPGVPIDQMDMEMVTNLESKVDSLLLQLKEHAKKLTDAASSSNVAPTR 164 ++G VGWPGVPIDQMDMEMVTNLESK+D+LLLQL+EHAKKLT+ A SSNV P++ Sbjct: 127 QDGIVGWPGVPIDQMDMEMVTNLESKIDNLLLQLEEHAKKLTEEA-SSNVPPSK 179