BLASTX nr result
ID: Gardenia21_contig00023584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00023584 (452 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99890.1| unnamed protein product [Coffea canephora] 62 1e-07 emb|CDP20481.1| unnamed protein product [Coffea canephora] 62 1e-07 >emb|CDO99890.1| unnamed protein product [Coffea canephora] Length = 252 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 451 AISLCFASMLKPNTSNQPSEVDAENIEAPLLS 356 AISLCFASMLKPNTSNQPSEVDAEN EAP LS Sbjct: 221 AISLCFASMLKPNTSNQPSEVDAENAEAPFLS 252 >emb|CDP20481.1| unnamed protein product [Coffea canephora] Length = 104 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 451 AISLCFASMLKPNTSNQPSEVDAENIEAPLLS 356 AISLCFASMLKPNTSNQPSEVDAEN EAP LS Sbjct: 73 AISLCFASMLKPNTSNQPSEVDAENAEAPFLS 104