BLASTX nr result
ID: Gardenia21_contig00021212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00021212 (489 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00396.1| unnamed protein product [Coffea canephora] 60 5e-07 ref|XP_007045953.1| UvrB/uvrC motif-containing protein isoform 4... 56 9e-06 >emb|CDP00396.1| unnamed protein product [Coffea canephora] Length = 338 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 89 QVLVDVYMDPNLLVAYVPEENLYAPDKPD 3 QVLVDVYMDPNLLVAYVPEENL APDKPD Sbjct: 258 QVLVDVYMDPNLLVAYVPEENLCAPDKPD 286 >ref|XP_007045953.1| UvrB/uvrC motif-containing protein isoform 4 [Theobroma cacao] gi|508709888|gb|EOY01785.1| UvrB/uvrC motif-containing protein isoform 4 [Theobroma cacao] Length = 326 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = -2 Query: 161 LFVYDQKICFYKHEIFCSSTSTVPQVLVDVYMDPNLLVAYVPEENLYAPDKPD 3 +F Y +C + C S+S + VDVY DPNLLVAYVPEENL AP++PD Sbjct: 219 IFGYRAVVCGMD-PVCCESSSWMETAQVDVYADPNLLVAYVPEENLLAPEQPD 270