BLASTX nr result
ID: Gardenia21_contig00021025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00021025 (274 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10244.1| unnamed protein product [Coffea canephora] 80 8e-13 >emb|CDP10244.1| unnamed protein product [Coffea canephora] Length = 438 Score = 79.7 bits (195), Expect = 8e-13 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = -2 Query: 135 MACGSVNSQFGTALLWHAKLKNVSPRLQLLENKTQWSLSSLDSLK 1 MA GSVNSQFGTALLWHAKLKNVSPRLQLLENK Q LSSLDSLK Sbjct: 1 MAWGSVNSQFGTALLWHAKLKNVSPRLQLLENKPQRVLSSLDSLK 45