BLASTX nr result
ID: Gardenia21_contig00020490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00020490 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15159.1| unnamed protein product [Coffea canephora] 66 7e-15 >emb|CDP15159.1| unnamed protein product [Coffea canephora] Length = 475 Score = 66.2 bits (160), Expect(2) = 7e-15 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +2 Query: 2 APVKRKETKCILGSPKSRVNLKIIFGKASLKYRPR 106 AP+KRKETKCILGSPKS+VNLK+IFGKA+LK+RPR Sbjct: 358 APLKRKETKCILGSPKSQVNLKMIFGKATLKHRPR 392 Score = 40.8 bits (94), Expect(2) = 7e-15 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +3 Query: 168 QELAASAREPQKPWKQQRKL 227 QELA+SAREP+KPWKQ+RKL Sbjct: 393 QELASSAREPEKPWKQRRKL 412