BLASTX nr result
ID: Gardenia21_contig00020448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00020448 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00869.1| unnamed protein product [Coffea canephora] 83 9e-14 >emb|CDP00869.1| unnamed protein product [Coffea canephora] Length = 385 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/49 (81%), Positives = 41/49 (83%) Frame = -2 Query: 148 MWGITATRPGPIRCYGNGVGEKRLGFAGTVPKDARRSQFLNISRPRLQE 2 MWGITATRP PIRCY NG GEKRLGFAGTV KDA+RSQFL I P LQE Sbjct: 1 MWGITATRPCPIRCYSNGFGEKRLGFAGTVVKDAQRSQFLKIYIPFLQE 49