BLASTX nr result
ID: Gardenia21_contig00018837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018837 (567 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013463478.1| hypothetical protein MTR_2g040760 [Medicago ... 64 7e-08 >ref|XP_013463478.1| hypothetical protein MTR_2g040760 [Medicago truncatula] gi|657397869|gb|KEH37513.1| hypothetical protein MTR_2g040760 [Medicago truncatula] Length = 343 Score = 63.5 bits (153), Expect = 7e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 516 LERKSCLVIPRLQHVRSITSHTTAAISRTDRYLTCTVTYI 397 +ERKSCLVIPRLQHVRS+T AA+ RTDR LTCT TY+ Sbjct: 125 IERKSCLVIPRLQHVRSLTPRAAAAVYRTDRRLTCTGTYV 164