BLASTX nr result
ID: Gardenia21_contig00018814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018814 (487 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15052.1| unnamed protein product [Coffea canephora] 60 8e-07 >emb|CDP15052.1| unnamed protein product [Coffea canephora] Length = 280 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/38 (76%), Positives = 30/38 (78%), Gaps = 3/38 (7%) Frame = -1 Query: 487 DLFLRQFCDAHTCSGGKKPFSRGGRVS---FYCYLSSL 383 DLFLRQFCDAHTCSGGKKPFSRGGR FY +S L Sbjct: 204 DLFLRQFCDAHTCSGGKKPFSRGGRKHTNVFYLAISIL 241