BLASTX nr result
ID: Gardenia21_contig00018741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018741 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20514.1| unnamed protein product [Coffea canephora] 116 6e-24 >emb|CDP20514.1| unnamed protein product [Coffea canephora] Length = 139 Score = 116 bits (291), Expect = 6e-24 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = -1 Query: 199 LVHGLFQSLIRQLQMEAEDFLHKKVHYNRWAAALHEIMPKEGTDWERLNFLLSELRREGK 20 L +G F SLIRQLQMEAEDFL K++HYNRWAAALHEIMPKEGTDW+RLN LLSELRREGK Sbjct: 63 LYNGFFHSLIRQLQMEAEDFLSKRIHYNRWAAALHEIMPKEGTDWQRLNCLLSELRREGK 122 Query: 19 EKKLFQ 2 E + FQ Sbjct: 123 ENRFFQ 128