BLASTX nr result
ID: Gardenia21_contig00018695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018695 (254 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP21217.1| unnamed protein product [Coffea canephora] 82 2e-13 >emb|CDP21217.1| unnamed protein product [Coffea canephora] Length = 569 Score = 82.0 bits (201), Expect = 2e-13 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 4/51 (7%) Frame = -1 Query: 143 METVVSVEVNEEAKAEDRITKETGSEPVSLKHVSDPD----PDPVVYKLVR 3 METVVS+EVNEEAK ED I KETGSEPVSLKH+SDPD PDPVVYKLVR Sbjct: 1 METVVSMEVNEEAKVEDGIAKETGSEPVSLKHISDPDPDPEPDPVVYKLVR 51