BLASTX nr result
ID: Gardenia21_contig00018429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018429 (529 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO96744.1| unnamed protein product [Coffea canephora] 67 5e-09 >emb|CDO96744.1| unnamed protein product [Coffea canephora] Length = 80 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -1 Query: 247 MCDCCGEGCECHXXXXXXXXXFALISCLLSLVGVVIWIVG 128 MCDCCGEGCECH FALISCLLS+VGVVIWIVG Sbjct: 1 MCDCCGEGCECHPLGFLLGLPFALISCLLSIVGVVIWIVG 40