BLASTX nr result
ID: Gardenia21_contig00018321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00018321 (861 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17899.1| unnamed protein product [Coffea canephora] 67 2e-08 >emb|CDP17899.1| unnamed protein product [Coffea canephora] Length = 252 Score = 66.6 bits (161), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 QFGRYQFPEEHPFFPDNLPDSLVPPNSHPQ 3 ++GRYQFPEEH FFPDNLPDSLVPPNSHPQ Sbjct: 68 KYGRYQFPEEHAFFPDNLPDSLVPPNSHPQ 97