BLASTX nr result
ID: Gardenia21_contig00017515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017515 (343 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP21205.1| unnamed protein product [Coffea canephora] 99 1e-18 >emb|CDP21205.1| unnamed protein product [Coffea canephora] Length = 260 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 160 MYTARFLMQPILRGSLTSIKSPYSYLSHPNFPAVMRGDHGSLQKCLNAVKAK 5 MYTARFLMQPILRGSL S+KSPYSYL HPNFPAVMRGDHG+LQK LNA+KAK Sbjct: 1 MYTARFLMQPILRGSLASVKSPYSYLYHPNFPAVMRGDHGNLQKWLNAIKAK 52