BLASTX nr result
ID: Gardenia21_contig00017502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017502 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98474.1| unnamed protein product [Coffea canephora] 97 4e-18 >emb|CDO98474.1| unnamed protein product [Coffea canephora] Length = 1445 Score = 97.4 bits (241), Expect = 4e-18 Identities = 55/65 (84%), Positives = 56/65 (86%), Gaps = 2/65 (3%) Frame = -1 Query: 228 KAPPVDLCRKKGDPGSVASMQPNP-GETSGAKVVIKPLDS-VNATQNSSSHRLKIKIKKR 55 KAPPV RKK D GS AS QPNP GETSGAKVVIKPLDS VNATQ+SSSHRLKIKIKKR Sbjct: 1380 KAPPVGSDRKKDDAGSGASAQPNPPGETSGAKVVIKPLDSSVNATQSSSSHRLKIKIKKR 1439 Query: 54 TLEKP 40 TLEKP Sbjct: 1440 TLEKP 1444