BLASTX nr result
ID: Gardenia21_contig00017281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017281 (746 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01562.1| unnamed protein product [Coffea canephora] 84 8e-14 ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910... 63 2e-07 ref|XP_002533683.1| conserved hypothetical protein [Ricinus comm... 63 2e-07 >emb|CDP01562.1| unnamed protein product [Coffea canephora] Length = 514 Score = 84.3 bits (207), Expect = 8e-14 Identities = 40/50 (80%), Positives = 42/50 (84%) Frame = -3 Query: 150 MGRYTPRQNNRRGAMASLFVLLLPILFPSLFTPLSIASSSIVSEWNVAKP 1 MGRY PRQNNRRGAM LFVLLLPILFPSLF PLS AS S++SEWN KP Sbjct: 1 MGRYPPRQNNRRGAMPILFVLLLPILFPSLFAPLSHASPSVISEWNTPKP 50 >ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana sylvestris] Length = 512 Score = 63.2 bits (152), Expect = 2e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 132 RQNNRRGAMASLFVLLLPILFPSLFTPLSIASSSIVSEWNVAKP 1 R ++R G MA +F+LLLPI FPSLFTPLS AS SI SEWN KP Sbjct: 6 RSSHRSGTMAGVFLLLLPIFFPSLFTPLSHASPSIFSEWNAPKP 49 >ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis] gi|223526418|gb|EEF28699.1| conserved hypothetical protein [Ricinus communis] Length = 509 Score = 63.2 bits (152), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 123 NRRGAMASLFVLLLPILFPSLFTPLSIASSSIVSEWNVAKP 1 +RRGA+A FVLLLP+LFPSLFTPL+ AS S SEWNV KP Sbjct: 5 HRRGALAGAFVLLLPLLFPSLFTPLTHASPSTFSEWNVPKP 45