BLASTX nr result
ID: Gardenia21_contig00016472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016472 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14010.1| unnamed protein product [Coffea canephora] 79 2e-12 ref|XP_009797473.1| PREDICTED: LOW QUALITY PROTEIN: N-(5'-phosph... 70 8e-10 ref|XP_009594365.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 70 8e-10 ref|XP_013620519.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 ref|XP_010322191.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 ref|XP_010322188.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 ref|XP_009797150.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 ref|XP_013676143.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 ref|XP_004240933.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 5e-09 gb|ADZ24713.1| phosphoribosylanthranilate isomerase [Solanum pen... 67 5e-09 ref|XP_011076706.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_011076705.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_011076701.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_009345753.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_008233768.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_006362404.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_006362402.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_006362401.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_006362400.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate... 67 7e-09 ref|XP_009125610.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate... 66 1e-08 >emb|CDP14010.1| unnamed protein product [Coffea canephora] Length = 277 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNFL 187 EALSALRP GVDVSSGICGPDGI+KDESLILSFMNAVRS N L Sbjct: 232 EALSALRPHGVDVSSGICGPDGIQKDESLILSFMNAVRSANVL 274 >ref|XP_009797473.1| PREDICTED: LOW QUALITY PROTEIN: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana sylvestris] Length = 196 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMNAV+SV Sbjct: 155 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNAVKSV 194 >ref|XP_009594365.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana tomentosiformis] gi|697170883|ref|XP_009594366.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana tomentosiformis] gi|697170885|ref|XP_009594367.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana tomentosiformis] gi|697170887|ref|XP_009594368.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana tomentosiformis] Length = 275 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMNAV+SV Sbjct: 234 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNAVKSV 273 >ref|XP_013620519.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Brassica oleracea var. oleracea] Length = 276 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS L+PDG+DVSSGICGPDGI+KD+S I SF+ AVRSV + Sbjct: 235 EALSILQPDGIDVSSGICGPDGIQKDQSKISSFITAVRSVQY 276 >ref|XP_010322191.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X2 [Solanum lycopersicum] Length = 275 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVN 193 EALSAL+P+GVDVSSGICG DGI+KDES I SFMNAV+S++ Sbjct: 234 EALSALKPNGVDVSSGICGQDGIKKDESRIQSFMNAVKSLH 274 >ref|XP_010322188.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Solanum lycopersicum] gi|723706188|ref|XP_010322189.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Solanum lycopersicum] gi|723706191|ref|XP_010322190.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Solanum lycopersicum] Length = 301 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVN 193 EALSAL+P+GVDVSSGICG DGI+KDES I SFMNAV+S++ Sbjct: 260 EALSALKPNGVDVSSGICGQDGIKKDESRIQSFMNAVKSLH 300 >ref|XP_009797150.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana sylvestris] gi|698503065|ref|XP_009797151.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Nicotiana sylvestris] Length = 275 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KD S ILSFMNAV+SV Sbjct: 234 EALSALKPNGVDVSSGICGQDGIQKDVSRILSFMNAVKSV 273 >ref|XP_013676143.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Brassica napus] gi|674919124|emb|CDY14106.1| BnaC02g02230D [Brassica napus] Length = 276 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS L+PDG+DVSSGICGPDGI+KD+S I SF+ AVRSV + Sbjct: 235 EALSILQPDGIDVSSGICGPDGIQKDQSKISSFITAVRSVQY 276 >ref|XP_004240933.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X3 [Solanum lycopersicum] Length = 269 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVN 193 EALSAL+P+GVDVSSGICG DGI+KDES I SFMNAV+S++ Sbjct: 228 EALSALKPNGVDVSSGICGQDGIKKDESRIQSFMNAVKSLH 268 >gb|ADZ24713.1| phosphoribosylanthranilate isomerase [Solanum pennellii] Length = 275 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVN 193 EALSAL+P+GVDVSSGICG DGI+KDES I SFMNAV+S++ Sbjct: 234 EALSALKPNGVDVSSGICGQDGIKKDESRIQSFMNAVKSLH 274 >ref|XP_011076706.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X3 [Sesamum indicum] gi|747060545|ref|XP_011076707.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X3 [Sesamum indicum] gi|747060547|ref|XP_011076708.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X3 [Sesamum indicum] Length = 234 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS LRP+G+DVSSGIC PDGI+KD+S ILSFM AV SV++ Sbjct: 193 EALSTLRPNGIDVSSGICAPDGIQKDKSRILSFMKAVNSVHY 234 >ref|XP_011076705.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X2 [Sesamum indicum] Length = 273 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS LRP+G+DVSSGIC PDGI+KD+S ILSFM AV SV++ Sbjct: 232 EALSTLRPNGIDVSSGICAPDGIQKDKSRILSFMKAVNSVHY 273 >ref|XP_011076701.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Sesamum indicum] gi|747060537|ref|XP_011076702.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Sesamum indicum] gi|747060539|ref|XP_011076704.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X1 [Sesamum indicum] Length = 287 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS LRP+G+DVSSGIC PDGI+KD+S ILSFM AV SV++ Sbjct: 246 EALSTLRPNGIDVSSGICAPDGIQKDKSRILSFMKAVNSVHY 287 >ref|XP_009345753.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like [Pyrus x bretschneideri] Length = 147 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVN 193 EALS L+P G+DVSSGICGPDGI+KD+ I SFM+AVRSVN Sbjct: 107 EALSVLKPQGIDVSSGICGPDGIQKDQMRISSFMSAVRSVN 147 >ref|XP_008233768.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic [Prunus mume] Length = 276 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS L+P G+DVSSGICGPDGI+KDE I SFM+AV SVN+ Sbjct: 235 EALSTLKPQGIDVSSGICGPDGIQKDELRISSFMSAVHSVNY 276 >ref|XP_006362404.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X5 [Solanum tuberosum] gi|565393483|ref|XP_006362405.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X6 [Solanum tuberosum] Length = 269 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMN V+S+ Sbjct: 228 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNEVKSL 267 >ref|XP_006362402.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X3 [Solanum tuberosum] gi|565393479|ref|XP_006362403.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X4 [Solanum tuberosum] Length = 276 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMN V+S+ Sbjct: 235 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNEVKSL 274 >ref|XP_006362401.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 278 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMN V+S+ Sbjct: 237 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNEVKSL 276 >ref|XP_006362400.1| PREDICTED: n-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 305 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSV 196 EALSAL+P+GVDVSSGICG DGI+KDES ILSFMN V+S+ Sbjct: 264 EALSALKPNGVDVSSGICGQDGIQKDESRILSFMNEVKSL 303 >ref|XP_009125610.1| PREDICTED: N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic isoform X2 [Brassica rapa] Length = 276 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 315 EALSALRPDGVDVSSGICGPDGIRKDESLILSFMNAVRSVNF 190 EALS L PDG+DVSSGICGPDG++KD+S I SF+ AVRSV + Sbjct: 235 EALSILHPDGIDVSSGICGPDGLQKDQSKISSFITAVRSVQY 276