BLASTX nr result
ID: Gardenia21_contig00016443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016443 (455 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP21869.1| unnamed protein product [Coffea canephora] 121 2e-25 ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 111 2e-22 ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 109 7e-22 ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricin... 109 7e-22 ref|XP_012844638.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron... 107 3e-21 gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythra... 107 3e-21 gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirs... 107 5e-21 ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Py... 106 6e-21 ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Ma... 106 6e-21 ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 106 8e-21 ref|XP_012071089.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Ja... 105 1e-20 ref|XP_012455836.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 105 1e-20 ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prun... 104 3e-20 gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina] 103 5e-20 gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sin... 103 5e-20 ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 103 5e-20 ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citr... 103 5e-20 ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-lik... 103 7e-20 ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Ci... 103 7e-20 ref|XP_013685438.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Br... 102 9e-20 >emb|CDP21869.1| unnamed protein product [Coffea canephora] Length = 450 Score = 121 bits (304), Expect = 2e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVPYTHANVSLAYKDFGY+PTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDAT EH Sbjct: 392 RNGDVPYTHANVSLAYKDFGYQPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATNEH 449 >ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis] Length = 453 Score = 111 bits (278), Expect = 2e-22 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVP+THANVSLAY+DFGYKPTTDLS+GLRKFVKWYLSYYGIQSKV KE+D+ +H Sbjct: 393 RNGDVPFTHANVSLAYRDFGYKPTTDLSSGLRKFVKWYLSYYGIQSKVNKELDSPNDH 450 >ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris] Length = 453 Score = 109 bits (273), Expect = 7e-22 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVP+THANVSLAY+DFGYKPTTDLS+GLRKFVKWYLSYYGIQSKV KE+++ +H Sbjct: 393 RNGDVPFTHANVSLAYRDFGYKPTTDLSSGLRKFVKWYLSYYGIQSKVNKELNSPNDH 450 >ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] gi|223538048|gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] Length = 401 Score = 109 bits (273), Expect = 7e-22 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVPYTHANVSLAYKDFGYKPTTDLS+GLRKFVKWY+ YYGIQ+KVK + D TEH Sbjct: 341 RNGDVPYTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVGYYGIQTKVKTQNDINTEH 398 >ref|XP_012844638.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6 [Erythranthe guttatus] Length = 462 Score = 107 bits (267), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATT 286 RNGDVPYTHANVSLAYKDFGYKPTTDL+TGLRKFVKWY+SYYGI+S+VKKE + T Sbjct: 401 RNGDVPYTHANVSLAYKDFGYKPTTDLATGLRKFVKWYVSYYGIESRVKKENEPNT 456 >gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythranthe guttata] Length = 369 Score = 107 bits (267), Expect = 3e-21 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATT 286 RNGDVPYTHANVSLAYKDFGYKPTTDL+TGLRKFVKWY+SYYGI+S+VKKE + T Sbjct: 308 RNGDVPYTHANVSLAYKDFGYKPTTDLATGLRKFVKWYVSYYGIESRVKKENEPNT 363 >gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum] Length = 454 Score = 107 bits (266), Expect = 5e-21 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTE 283 RNGDVP+THANV+LA+KDFGYKPTTDLSTGLRKFVKWY+SYYGIQSK +KE AT E Sbjct: 396 RNGDVPFTHANVTLAFKDFGYKPTTDLSTGLRKFVKWYISYYGIQSKTRKESQATGE 452 >ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri] Length = 465 Score = 106 bits (265), Expect = 6e-21 Identities = 46/54 (85%), Positives = 54/54 (100%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDA 292 RNGDVPYTHANV+LAYKDFGYKPTTDL++GLRKFVKWY+SYYGI+S+VKKE+D+ Sbjct: 400 RNGDVPYTHANVTLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIESRVKKEMDS 453 >ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica] Length = 465 Score = 106 bits (265), Expect = 6e-21 Identities = 46/54 (85%), Positives = 54/54 (100%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDA 292 RNGDVPYTHANV+LAYKDFGYKPTTDL++GLRKFVKWY+SYYGI+S+VKKE+D+ Sbjct: 400 RNGDVPYTHANVTLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIESRVKKEMDS 453 >ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica] gi|743943465|ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica] Length = 456 Score = 106 bits (264), Expect = 8e-21 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVPYTHANV+LAY+DFGYKPTTDL+TGLRKFVKWY+ YYGIQ++VKK D +EH Sbjct: 394 RNGDVPYTHANVTLAYRDFGYKPTTDLATGLRKFVKWYVDYYGIQTRVKKYSDINSEH 451 >ref|XP_012071089.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Jatropha curcas] gi|643732139|gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas] Length = 458 Score = 105 bits (263), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANVSLAYKDFGYKPTTDLS+GLRKFVKWY+SYYGIQ++VKKE Sbjct: 397 RNGDVPYTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVSYYGIQTRVKKE 447 >ref|XP_012455836.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Gossypium raimondii] gi|763805070|gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii] Length = 454 Score = 105 bits (262), Expect = 1e-20 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTE 283 RNGDVP+THANV+LA+KDFGYKPTTDLSTGLRKFVKWY+SYYGIQSK KE AT E Sbjct: 396 RNGDVPFTHANVTLAFKDFGYKPTTDLSTGLRKFVKWYISYYGIQSKTGKESQATGE 452 >ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica] gi|462420068|gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica] Length = 461 Score = 104 bits (259), Expect = 3e-20 Identities = 45/53 (84%), Positives = 52/53 (98%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEID 295 RNGDVPYTHANVSLAYKDFGYKPTTDL++GLRKFVKWY+SYYGI ++VK+E+D Sbjct: 396 RNGDVPYTHANVSLAYKDFGYKPTTDLASGLRKFVKWYVSYYGIDTRVKREMD 448 >gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina] Length = 458 Score = 103 bits (257), Expect = 5e-20 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTE 283 RNGDVPYTHANVSLAYKDFGYKPTTDL+ GLRKFVKWY+SYYG+Q +VKKE E Sbjct: 400 RNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGVQPRVKKETSHAEE 456 >gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis] Length = 469 Score = 103 bits (257), Expect = 5e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANVSLAYKDFGYKPTTDL+ GLRKFVKWY+SYYGIQ +VKKE Sbjct: 402 RNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE 452 >ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis] gi|641822578|gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis] Length = 476 Score = 103 bits (257), Expect = 5e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANVSLAYKDFGYKPTTDL+ GLRKFVKWY+SYYGIQ +VKKE Sbjct: 409 RNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE 459 >ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina] gi|557522897|gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina] Length = 476 Score = 103 bits (257), Expect = 5e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANVSLAYKDFGYKPTTDL+ GLRKFVKWY+SYYGIQ +VKKE Sbjct: 409 RNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVSYYGIQPRVKKE 459 >ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica] Length = 456 Score = 103 bits (256), Expect = 7e-20 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATTEH 280 RNGDVPYTHANV+LA+KDFGYKPTTDL+TGLRKFVKWY++YYGIQ++VKK +EH Sbjct: 394 RNGDVPYTHANVTLAFKDFGYKPTTDLATGLRKFVKWYVNYYGIQTRVKKGSAINSEH 451 >ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cicer arietinum] Length = 451 Score = 103 bits (256), Expect = 7e-20 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANV+LAYKDFGYKPTTDL+TGLRKFVKWY+ YYGIQS++KKE Sbjct: 389 RNGDVPYTHANVTLAYKDFGYKPTTDLATGLRKFVKWYVRYYGIQSRLKKE 439 >ref|XP_013685438.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica napus] Length = 456 Score = 102 bits (255), Expect = 9e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 453 RNGDVPYTHANVSLAYKDFGYKPTTDLSTGLRKFVKWYLSYYGIQSKVKKE 301 RNGDVPYTHANVSLAY+DFGYKPTTDL+TGLRKFVKWY+ YYGIQ +VKKE Sbjct: 398 RNGDVPYTHANVSLAYRDFGYKPTTDLATGLRKFVKWYVGYYGIQPRVKKE 448