BLASTX nr result
ID: Gardenia21_contig00016372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016372 (484 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlise... 91 3e-16 ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapan... 82 1e-13 ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapan... 82 1e-13 ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassai... 82 1e-13 ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassai... 82 1e-13 gb|AFK38361.1| unknown [Medicago truncatula] 73 7e-11 gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinque... 72 2e-10 gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sin... 71 4e-10 ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopan... 70 6e-10 ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopan... 70 6e-10 gb|ALM87817.1| ribosomal protein S12 (chloroplast) [Cymbidium go... 70 8e-10 ref|YP_009180170.1| ribosomal protein S12 (chloroplast) [Dendrob... 70 8e-10 ref|YP_009179975.1| ribosomal protein S12 (chloroplast) [Bletill... 70 8e-10 gb|AKJ83577.1| ribosomal protein S12 (chloroplast) [Alocasia mac... 70 8e-10 ref|YP_009161851.1| ribosomal protein S12 (chloroplast) [Dendrob... 70 8e-10 ref|YP_009161578.1| ribosomal protein S12 (chloroplast) [Pinelli... 70 8e-10 ref|YP_009144958.1| ribosomal protein S12 (chloroplast) [Dieffen... 70 8e-10 gb|AKJ77464.1| ribosomal protein S12 (chloroplast) [Carthamus ti... 69 1e-09 ref|YP_009144538.1| ribosomal protein S12 (chloroplast) [Rosmari... 69 2e-09 ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberi... 69 2e-09 >gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlisea aurea] Length = 106 Score = 90.9 bits (224), Expect = 3e-16 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 4/93 (4%) Frame = +2 Query: 218 IGFAPMETIKFIHNGGI*EIVLFF--R**MESPLPYSSVRIIDTG--GLFFCFCACS*YD 385 IGFAPM+TI+FIH +V F S L YS II +G GL F + +D Sbjct: 1 IGFAPMKTIRFIHISSYLVLVFFLIVNGVRSSCLCYSLRHIIPSGKPGLLVFFVSA--HD 58 Query: 386 LNESHIHPSTCSSTLRASPKGGGLRDISYWLSC 484 LNESHIHPSTCSSTLR SPKGGG RDIS WLSC Sbjct: 59 LNESHIHPSTCSSTLRTSPKGGGFRDISNWLSC 91 >ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599431|gb|AGG39190.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 161 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQPPSINDTYRRI 317 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S K KK SIND YRRI Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS--WDKRKKTFSSINDPYRRI 64 >ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599418|gb|AGG39177.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 165 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQPPSINDTYRRI 317 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S K KK SIND YRRI Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS--WDKRKKTFSSINDPYRRI 64 >ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603148|ref|YP_008815141.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940339|ref|YP_008814880.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599150|gb|AGG39016.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599252|gb|AGG39103.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599584|gb|AGG39277.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 149 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQPPSINDTYRRI 317 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S K KK SIND YRRI Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS--WDKRKKTFSSINDPYRRI 64 >ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603135|ref|YP_008815096.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940326|ref|YP_008814835.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599137|gb|AGG39003.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599239|gb|AGG39090.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599571|gb|AGG39264.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 150 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQPPSINDTYRRI 317 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S K KK SIND YRRI Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS--WDKRKKTFSSINDPYRRI 64 >gb|AFK38361.1| unknown [Medicago truncatula] Length = 82 Score = 73.2 bits (178), Expect = 7e-11 Identities = 42/69 (60%), Positives = 47/69 (68%) Frame = -2 Query: 213 MRNNSPLVTNGYPLSGEIFI*KV*RVGPYSDKNGLRRSVTQLIFRIKYRYGIGRSRCERP 34 M+N PLVTN YPLSG+ I ++ P NGLR S TQLIF +KYRY I R CERP Sbjct: 1 MKNTFPLVTNSYPLSGKNPILNK-KLCPKFCNNGLRGSTTQLIFILKYRYCIARFCCERP 59 Query: 33 ITR*FMGRA 7 ITR FMGRA Sbjct: 60 ITRYFMGRA 68 >gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinquefolius] Length = 65 Score = 72.0 bits (175), Expect = 2e-10 Identities = 40/55 (72%), Positives = 41/55 (74%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQPPSINDTYRRI 317 RQPIRNV KSPALRGCPQRRGTCTR YV LV I+S K KK SIND YR I Sbjct: 12 RQPIRNVPKSPALRGCPQRRGTCTRGYVGLVQIMS--WDKRKKTFSSINDPYRGI 64 >gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sinensis] Length = 60 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTKAKKQ 350 RQPIRNVTKSPAL GCPQRRGTCTRVYVRLV I+ TK +KQ Sbjct: 12 RQPIRNVTKSPALGGCPQRRGTCTRVYVRLVQIMGWDKTKERKQ 55 >ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599672|gb|AGG39364.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 142 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS 377 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS 46 >ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599659|gb|AGG39351.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 143 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS 377 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I+S Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMS 46 >gb|ALM87817.1| ribosomal protein S12 (chloroplast) [Cymbidium goeringii] gi|948550076|gb|ALM87854.1| ribosomal protein S12 (chloroplast) [Cymbidium goeringii] gi|948550120|gb|ALM87897.1| ribosomal protein S12 (chloroplast) [Cymbidium ensifolium] gi|948550155|gb|ALM87932.1| ribosomal protein S12 (chloroplast) [Cymbidium ensifolium] Length = 130 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_009180170.1| ribosomal protein S12 (chloroplast) [Dendrobium huoshanense] gi|953245052|ref|YP_009180212.1| ribosomal protein S12 (chloroplast) [Dendrobium huoshanense] gi|944543418|gb|ALL96607.1| ribosomal protein S12 (chloroplast) [Dendrobium huoshanense] gi|944543419|gb|ALL96608.1| ribosomal protein S12 (chloroplast) [Dendrobium huoshanense] Length = 130 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_009179975.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|953244808|ref|YP_009179932.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|943496681|gb|ALL53022.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|943496716|gb|ALL53057.1| ribosomal protein S12 (chloroplast) [Bletilla striata] Length = 127 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >gb|AKJ83577.1| ribosomal protein S12 (chloroplast) [Alocasia macrorrhizos] gi|827505301|gb|AKJ83578.1| ribosomal protein S12 (chloroplast) [Alocasia macrorrhizos] Length = 131 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_009161851.1| ribosomal protein S12 (chloroplast) [Dendrobium strongylanthum] gi|906346852|gb|AKS28643.1| ribosomal protein S12 (chloroplast) [Dendrobium strongylanthum] Length = 46 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_009161578.1| ribosomal protein S12 (chloroplast) [Pinellia ternata] gi|827505726|gb|AKJ83713.1| ribosomal protein S12 (chloroplast) [Pinellia ternata] Length = 127 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_009144958.1| ribosomal protein S12 (chloroplast) [Dieffenbachia seguine] gi|836643753|ref|YP_009145003.1| ribosomal protein S12 (chloroplast) [Dieffenbachia seguine] gi|910355713|ref|YP_009161533.1| ribosomal protein S12 (chloroplast) [Pinellia ternata] gi|827504909|gb|AKJ83495.1| ribosomal protein S12 (chloroplast) [Dieffenbachia seguine] gi|827504910|gb|AKJ83496.1| ribosomal protein S12 (chloroplast) [Dieffenbachia seguine] gi|827505766|gb|AKJ83753.1| ribosomal protein S12 (chloroplast) [Pinellia ternata] Length = 127 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 484 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 389 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 11 ARQPIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >gb|AKJ77464.1| ribosomal protein S12 (chloroplast) [Carthamus tinctorius] Length = 138 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS*AGTK 362 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV I++ +G+K Sbjct: 12 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMN-SGSK 50 >ref|YP_009144538.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|836643444|ref|YP_009144494.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|827345164|gb|AKJ76748.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|827345204|gb|AKJ76788.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] Length = 128 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*IIS 377 RQP+RNVTKSPALRGCPQRRGTCTRVYVRLV +I+ Sbjct: 12 RQPVRNVTKSPALRGCPQRRGTCTRVYVRLVYMIT 46 >ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462705|gb|AGU37070.1| ribosomal protein S12 (chloroplast) [Berberis bealei] Length = 46 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 481 RQPIRNVTKSPALRGCPQRRGTCTRVYVRLV*II 380 RQPI+NVTKSPALRGCPQRRGTCTRVYVRLV II Sbjct: 12 RQPIKNVTKSPALRGCPQRRGTCTRVYVRLVQII 45