BLASTX nr result
ID: Gardenia21_contig00016331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016331 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045741.1| orf105a (mitochondrion) [Batis maritima] gi|... 80 5e-13 ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabac... 66 9e-09 ref|YP_009049767.1| hypothetical protein (mitochondrion) [Capsic... 58 2e-06 >ref|YP_009045741.1| orf105a (mitochondrion) [Batis maritima] gi|655168515|gb|AIC83344.1| orf105a (mitochondrion) [Batis maritima] Length = 105 Score = 80.5 bits (197), Expect = 5e-13 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 4/96 (4%) Frame = -1 Query: 324 LADLLDPLIQTEAEKSPNIRKLPSPRDMVEELIKRLASTKVHQENEGNAA--HFKNLKRW 151 LADL+ PL++ EA+ + K+P+ R++VE+LIKR + V + N N K L W Sbjct: 13 LADLIRPLVEKEAQ---GLTKIPASREVVEDLIKRAGTQLVQKANGPNPEWLDLKYLNTW 69 Query: 150 LTRACQNAEDETKGRMSIRSEIRAIIQE--YSQNDS 49 LTRACQNAED +GRM+IRSEIR II + + + DS Sbjct: 70 LTRACQNAEDPIRGRMNIRSEIRDIISKCIHDEKDS 105 >ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabacum] gi|56806553|dbj|BAD83454.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 222 Score = 66.2 bits (160), Expect = 9e-09 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 8/95 (8%) Frame = -1 Query: 324 LADLLDPLIQTEAEK------SPNIRKLPSPRDMVEELIKRLASTKVHQENEGNA--AHF 169 LA+ + PLI++E + N+ +LPSP +MVE +I R S + N+ N A+ Sbjct: 126 LAEQISPLIESEKARLVRRKWHRNLDELPSPSEMVEIIIDRFGSKAAYNANKPNVPRANL 185 Query: 168 KNLKRWLTRACQNAEDETKGRMSIRSEIRAIIQEY 64 ++L+ WLTRA +AE + KG MSI++ I +II+ Y Sbjct: 186 RHLRAWLTRAQHSAEQDGKGNMSIKNHISSIIEGY 220 >ref|YP_009049767.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751868|gb|AIG89955.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752039|gb|AIG90125.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 108 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = -1 Query: 327 RLADLLDPLIQTEAEKSPNIRKLPSPRDMVEELIKRLASTKVHQENEGNA 178 +LADLL+PLIQ EAE+ PNIR+LPSP+ MVE LI+ L S ++ + + A Sbjct: 48 KLADLLEPLIQREAERYPNIRELPSPKAMVERLIESLGSDQIKPKKKTRA 97