BLASTX nr result
ID: Gardenia21_contig00015880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015880 (1130 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19795.1| unnamed protein product [Coffea canephora] 43 7e-06 >emb|CDP19795.1| unnamed protein product [Coffea canephora] Length = 102 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 20/40 (50%), Positives = 27/40 (67%) Frame = -3 Query: 837 KLDLEDNSDNHSESKNEACSGMEEIQRCGAETYILRCKNF 718 K ED+S+NHS+ K++ACSGMEEIQR A + + F Sbjct: 27 KRRFEDSSNNHSKRKSKACSGMEEIQRLCAARICIHMQGF 66 Score = 36.2 bits (82), Expect(2) = 7e-06 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = -2 Query: 742 IYIEMQEFLSPHSLIQGRTAATSSKVFSIGQCTIAYHPKSR 620 I I MQ FLSP S +QGRTAA S F + PK++ Sbjct: 59 ICIHMQGFLSPRSKVQGRTAARSCNAFLNWTMDYTFPPKNK 99