BLASTX nr result
ID: Gardenia21_contig00015876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015876 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14144.1| unnamed protein product [Coffea canephora] 114 3e-23 >emb|CDP14144.1| unnamed protein product [Coffea canephora] Length = 944 Score = 114 bits (285), Expect = 3e-23 Identities = 53/61 (86%), Positives = 58/61 (95%) Frame = -2 Query: 280 ITEGGAISAPQEEHMSYAAVLMLIITPQLFSVFEAAKWTVGAFLGSFLQGGWPFVHITIF 101 + E AISAPQEEHMSYAAVLMLI+TPQLFSVFEAAKWTVGAFLGSFL+GGWPF+HITIF Sbjct: 500 LREVSAISAPQEEHMSYAAVLMLILTPQLFSVFEAAKWTVGAFLGSFLKGGWPFIHITIF 559 Query: 100 V 98 + Sbjct: 560 I 560