BLASTX nr result
ID: Gardenia21_contig00015803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015803 (398 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03825.1| unnamed protein product [Coffea canephora] 116 7e-24 >emb|CDP03825.1| unnamed protein product [Coffea canephora] Length = 326 Score = 116 bits (290), Expect = 7e-24 Identities = 59/71 (83%), Positives = 59/71 (83%) Frame = +2 Query: 185 SYFLIGCPGLNFDKKALGFSRHLNNCPKFAFFFSNVDQRLLRKVQLRRPGPSPITCSASN 364 SY LIGCP LN DKK LGFSRHLNNC KFAFFFSNVDQRLL KVQ RR GPS ITC ASN Sbjct: 8 SYSLIGCPSLNLDKKCLGFSRHLNNCRKFAFFFSNVDQRLLCKVQPRRLGPSLITCFASN 67 Query: 365 KQEISSAAKIR 397 K EISS AKIR Sbjct: 68 KPEISSTAKIR 78