BLASTX nr result
ID: Gardenia21_contig00015728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015728 (228 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011628623.1| PREDICTED: putative 12-oxophytodienoate redu... 78 2e-12 ref|XP_011628622.1| PREDICTED: putative 12-oxophytodienoate redu... 78 2e-12 ref|XP_008347406.1| PREDICTED: 12-oxophytodienoate reductase 2-l... 78 2e-12 ref|XP_006858594.1| PREDICTED: putative 12-oxophytodienoate redu... 78 2e-12 ref|XP_008339185.1| PREDICTED: 12-oxophytodienoate reductase 2-l... 78 3e-12 gb|KDO40987.1| hypothetical protein CISIN_1g017448mg [Citrus sin... 77 4e-12 ref|XP_006494222.1| PREDICTED: 12-oxophytodienoate reductase 1-l... 77 4e-12 ref|XP_010930415.1| PREDICTED: putative 12-oxophytodienoate redu... 77 5e-12 emb|CDP21815.1| unnamed protein product, partial [Coffea canephora] 77 5e-12 ref|XP_006858597.1| PREDICTED: putative 12-oxophytodienoate redu... 77 5e-12 gb|KQL30060.1| hypothetical protein SETIT_019840mg, partial [Set... 77 7e-12 ref|XP_010912703.1| PREDICTED: putative 12-oxophytodienoate redu... 77 7e-12 emb|CDP10746.1| unnamed protein product [Coffea canephora] 77 7e-12 ref|XP_004952765.1| PREDICTED: putative 12-oxophytodienoate redu... 77 7e-12 ref|XP_002454008.1| hypothetical protein SORBIDRAFT_04g022980 [S... 77 7e-12 ref|XP_011101214.1| PREDICTED: putative 12-oxophytodienoate redu... 76 9e-12 ref|XP_011095972.1| PREDICTED: putative 12-oxophytodienoate redu... 76 9e-12 ref|XP_011095964.1| PREDICTED: putative 12-oxophytodienoate redu... 76 9e-12 ref|XP_009362373.1| PREDICTED: putative 12-oxophytodienoate redu... 76 9e-12 ref|XP_008352810.1| PREDICTED: 12-oxophytodienoate reductase 2-l... 76 9e-12 >ref|XP_011628623.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform X3 [Amborella trichopoda] Length = 354 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDPV+GYTDYPF Sbjct: 316 LANPDLPKRFELNAPLNKYNRETFYTPDPVIGYTDYPF 353 >ref|XP_011628622.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform X1 [Amborella trichopoda] Length = 384 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDPV+GYTDYPF Sbjct: 346 LANPDLPKRFELNAPLNKYNRETFYTPDPVIGYTDYPF 383 >ref|XP_008347406.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] Length = 207 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDPV+GYTDYPF Sbjct: 165 LANPDLPKRFELNAPLNKYNRETFYTPDPVIGYTDYPF 202 >ref|XP_006858594.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform X2 [Amborella trichopoda] gi|548862703|gb|ERN20061.1| hypothetical protein AMTR_s00071p00196480 [Amborella trichopoda] Length = 374 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDPV+GYTDYPF Sbjct: 336 LANPDLPKRFELNAPLNKYNRETFYTPDPVIGYTDYPF 373 >ref|XP_008339185.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] Length = 369 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDP++GYTDYPF Sbjct: 327 LANPDLPKRFELNAPLNKYNRETFYTPDPIIGYTDYPF 364 >gb|KDO40987.1| hypothetical protein CISIN_1g017448mg [Citrus sinensis] Length = 371 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA+LN Y+R TFYTPDPVVGYTDYPF Sbjct: 329 LANPDLPKRFELNAALNKYDRSTFYTPDPVVGYTDYPF 366 >ref|XP_006494222.1| PREDICTED: 12-oxophytodienoate reductase 1-like [Citrus sinensis] Length = 372 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA+LN Y+R TFYTPDPVVGYTDYPF Sbjct: 330 LANPDLPKRFELNAALNKYDRSTFYTPDPVVGYTDYPF 367 >ref|XP_010930415.1| PREDICTED: putative 12-oxophytodienoate reductase 5 [Elaeis guineensis] Length = 365 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELN SLN Y+R TFYTPDPVVGYTDYPF Sbjct: 323 LANPDLPKRFELNTSLNKYDRSTFYTPDPVVGYTDYPF 360 >emb|CDP21815.1| unnamed protein product, partial [Coffea canephora] Length = 338 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFY PDPVVGYTDYPF Sbjct: 296 LANPDLPKRFELNAPLNTYNRATFYIPDPVVGYTDYPF 333 >ref|XP_006858597.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Amborella trichopoda] gi|548862706|gb|ERN20064.1| hypothetical protein AMTR_s00071p00197300 [Amborella trichopoda] Length = 374 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLP+RFELNA LN YNR TFYTPDPV+GYTDYPF Sbjct: 336 LANPDLPRRFELNAPLNKYNRETFYTPDPVIGYTDYPF 373 >gb|KQL30060.1| hypothetical protein SETIT_019840mg, partial [Setaria italica] Length = 346 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN Y+R TFYTPDPVVGYTDYPF Sbjct: 303 LANPDLPKRFELNAPLNKYDRSTFYTPDPVVGYTDYPF 340 >ref|XP_010912703.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Elaeis guineensis] Length = 365 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN Y+R TFYTPDPVVGYTDYPF Sbjct: 323 LANPDLPKRFELNAPLNKYDRSTFYTPDPVVGYTDYPF 360 >emb|CDP10746.1| unnamed protein product [Coffea canephora] Length = 516 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDPV GYTDYPF Sbjct: 340 LANPDLPKRFELNAPLNEYNRETFYTPDPVAGYTDYPF 377 >ref|XP_004952765.1| PREDICTED: putative 12-oxophytodienoate reductase 8 [Setaria italica] Length = 368 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN Y+R TFYTPDPVVGYTDYPF Sbjct: 325 LANPDLPKRFELNAPLNKYDRSTFYTPDPVVGYTDYPF 362 >ref|XP_002454008.1| hypothetical protein SORBIDRAFT_04g022980 [Sorghum bicolor] gi|241933839|gb|EES06984.1| hypothetical protein SORBIDRAFT_04g022980 [Sorghum bicolor] Length = 345 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN Y+R TFYTPDPVVGYTDYPF Sbjct: 303 LANPDLPKRFELNAPLNKYDRSTFYTPDPVVGYTDYPF 340 >ref|XP_011101214.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Sesamum indicum] Length = 377 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFY PDPVVGYTDYPF Sbjct: 335 LANPDLPKRFELNAPLNKYNRETFYIPDPVVGYTDYPF 372 >ref|XP_011095972.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform X2 [Sesamum indicum] Length = 341 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFY PDPVVGYTDYPF Sbjct: 299 LANPDLPKRFELNAPLNKYNRETFYIPDPVVGYTDYPF 336 >ref|XP_011095964.1| PREDICTED: putative 12-oxophytodienoate reductase 11 isoform X1 [Sesamum indicum] Length = 377 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFY PDPVVGYTDYPF Sbjct: 335 LANPDLPKRFELNAPLNKYNRETFYIPDPVVGYTDYPF 372 >ref|XP_009362373.1| PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x bretschneideri] Length = 376 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFE+NA+LN YNR TFYTP+PV+GYTDYPF Sbjct: 334 LANPDLPKRFEINATLNKYNRETFYTPNPVIGYTDYPF 371 >ref|XP_008352810.1| PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] Length = 368 Score = 76.3 bits (186), Expect = 9e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 226 LANPDLPKRFELNASLNMYNRVTFYTPDPVVGYTDYPF 113 LANPDLPKRFELNA LN YNR TFYTPDP +GYTDYPF Sbjct: 326 LANPDLPKRFELNAPLNKYNRETFYTPDPXIGYTDYPF 363