BLASTX nr result
ID: Gardenia21_contig00015631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015631 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05861.1| unnamed protein product [Coffea canephora] 85 2e-14 >emb|CDP05861.1| unnamed protein product [Coffea canephora] Length = 192 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +2 Query: 2 KMQEDVDVLKQQNQTCAEYSKELEPLKELTDEPMQSSAPAQADKKKVFIRSRL 160 KMQEDV++LKQQNQTCAE S+ELEPLKEL+DEP+Q+ AQ DKKKV IRSRL Sbjct: 140 KMQEDVNILKQQNQTCAECSRELEPLKELSDEPIQTPTSAQTDKKKVVIRSRL 192