BLASTX nr result
ID: Gardenia21_contig00015591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015591 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02802.1| unnamed protein product [Coffea canephora] 55 8e-06 >emb|CDP02802.1| unnamed protein product [Coffea canephora] Length = 441 Score = 54.7 bits (130), Expect(2) = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 116 LLRAGVQRVGHSKKFKKSGNERFVVEVNEFFMKE 15 LLRAGVQR GHSKKF KSGNERFVVEV+++ E Sbjct: 259 LLRAGVQRAGHSKKFDKSGNERFVVEVSKWVFHE 292 Score = 21.6 bits (44), Expect(2) = 8e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 30 VFHERGHHK 4 VFHERGH K Sbjct: 289 VFHERGHLK 297