BLASTX nr result
ID: Gardenia21_contig00015582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015582 (240 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02695.1| unnamed protein product [Coffea canephora] 65 2e-08 >emb|CDP02695.1| unnamed protein product [Coffea canephora] Length = 280 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/36 (91%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = -1 Query: 105 MECQI-ISTGVQPFLPRWNSNKGLKKLVRLNQASIR 1 MECQI ISTGV+PFL RWNSNKGLKKLVRLNQASIR Sbjct: 1 MECQILISTGVRPFLARWNSNKGLKKLVRLNQASIR 36