BLASTX nr result
ID: Gardenia21_contig00015513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015513 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08074.1| unnamed protein product [Coffea canephora] 68 3e-11 >emb|CDP08074.1| unnamed protein product [Coffea canephora] Length = 363 Score = 68.2 bits (165), Expect(2) = 3e-11 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -1 Query: 222 KAQWDKAMELRFCLEYVDWKKTGKWDQNAQADANWMRFGNHLNMLFGK 79 KA WD+ ME+ FC+ YV+WKK+G+W+ N +ANWM+ HLN +GK Sbjct: 51 KAYWDENMEMHFCMTYVEWKKSGEWNPNMSTEANWMKLAAHLNSSWGK 98 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 79 NSKL*QLKKI*RAYAKLKGYR 17 +SK +LK+I RA+AKLKG R Sbjct: 106 HSKYTRLKRIWRAFAKLKGLR 126