BLASTX nr result
ID: Gardenia21_contig00015387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015387 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008465538.1| PREDICTED: 17.6 kDa class I heat shock prote... 68 3e-09 gb|KCW52608.1| hypothetical protein EUGRSUZ_J01979 [Eucalyptus g... 68 3e-09 emb|CDP22094.1| unnamed protein product [Coffea canephora] gi|66... 67 4e-09 ref|XP_009793624.1| PREDICTED: 17.8 kDa class I heat shock prote... 67 7e-09 ref|XP_009589641.1| PREDICTED: 18.2 kDa class I heat shock prote... 67 7e-09 ref|XP_008463198.1| PREDICTED: 18.1 kDa class I heat shock prote... 67 7e-09 ref|XP_010426060.1| PREDICTED: 17.6 kDa class I heat shock prote... 66 9e-09 ref|XP_010514953.1| PREDICTED: 17.4 kDa class I heat shock prote... 66 9e-09 ref|XP_010503242.1| PREDICTED: 17.4 kDa class I heat shock prote... 66 9e-09 ref|XP_010503240.1| PREDICTED: 17.6 kDa class I heat shock prote... 66 9e-09 ref|XP_009770368.1| PREDICTED: 17.8 kDa class I heat shock prote... 66 9e-09 gb|AIE47707.1| HSP17.6 [Nicotiana tabacum] 66 9e-09 ref|XP_006291980.1| hypothetical protein CARUB_v10018169mg [Caps... 66 9e-09 ref|XP_004150235.2| PREDICTED: 18.1 kDa class I heat shock prote... 66 9e-09 ref|XP_002891756.1| 17.6 kDa class I small heat shock protein [A... 66 9e-09 emb|CDP19642.1| unnamed protein product [Coffea canephora] 66 1e-08 ref|XP_010426063.1| PREDICTED: 17.6 kDa class I heat shock prote... 65 2e-08 ref|XP_010426062.1| PREDICTED: 17.4 kDa class I heat shock prote... 65 2e-08 ref|XP_010241154.1| PREDICTED: 18.2 kDa class I heat shock prote... 65 2e-08 gb|KCW52589.1| hypothetical protein EUGRSUZ_J01958 [Eucalyptus g... 65 2e-08 >ref|XP_008465538.1| PREDICTED: 17.6 kDa class I heat shock protein 3-like [Cucumis melo] Length = 159 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 30 >gb|KCW52608.1| hypothetical protein EUGRSUZ_J01979 [Eucalyptus grandis] Length = 282 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -3 Query: 160 SSSEVVEHLTSQSSSTLVKNISEMSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 S+S + H TS + T MSLIPS FGGRRSNV+DPFSLD+WDPF+ F Sbjct: 98 SASPTINHQTSLNHLTAAAEAGTMSLIPSWFGGRRSNVYDPFSLDLWDPFKDF 150 >emb|CDP22094.1| unnamed protein product [Coffea canephora] gi|661879314|emb|CDP16970.1| unnamed protein product [Coffea canephora] gi|661879315|emb|CDP16971.1| unnamed protein product [Coffea canephora] Length = 138 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPS+FGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MSLIPSVFGGRRSNVFDPFSLDIWDPFEGF 30 >ref|XP_009793624.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Nicotiana sylvestris] Length = 177 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRRSN+FDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRSNIFDPFSLDLWDPFEGF 30 >ref|XP_009589641.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Nicotiana tomentosiformis] Length = 159 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRRSNVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRSNVFDPFSLDMWDPFEGF 30 >ref|XP_008463198.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Cucumis melo] Length = 159 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 M+LIPSIFGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MALIPSIFGGRRSNVFDPFSLDIWDPFEGF 30 >ref|XP_010426060.1| PREDICTED: 17.6 kDa class I heat shock protein 3 [Camelina sativa] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_010514953.1| PREDICTED: 17.4 kDa class I heat shock protein-like [Camelina sativa] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_010503242.1| PREDICTED: 17.4 kDa class I heat shock protein-like [Camelina sativa] Length = 152 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_010503240.1| PREDICTED: 17.6 kDa class I heat shock protein 3-like [Camelina sativa] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_009770368.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Nicotiana sylvestris] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPS FGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MSLIPSFFGGRRSNVFDPFSLDIWDPFEGF 30 >gb|AIE47707.1| HSP17.6 [Nicotiana tabacum] Length = 154 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPS FGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MSLIPSFFGGRRSNVFDPFSLDIWDPFEGF 30 >ref|XP_006291980.1| hypothetical protein CARUB_v10018169mg [Capsella rubella] gi|482560687|gb|EOA24878.1| hypothetical protein CARUB_v10018169mg [Capsella rubella] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_004150235.2| PREDICTED: 18.1 kDa class I heat shock protein-like [Cucumis sativus] gi|700195443|gb|KGN50620.1| hypothetical protein Csa_5G197620 [Cucumis sativus] Length = 159 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 M+L+PSIFGGRRSNVFDPFSLDIWDPFEGF Sbjct: 1 MALVPSIFGGRRSNVFDPFSLDIWDPFEGF 30 >ref|XP_002891756.1| 17.6 kDa class I small heat shock protein [Arabidopsis lyrata subsp. lyrata] gi|297337598|gb|EFH68015.1| 17.6 kDa class I small heat shock protein [Arabidopsis lyrata subsp. lyrata] Length = 157 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >emb|CDP19642.1| unnamed protein product [Coffea canephora] Length = 160 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 M+L+PSIFGGRRSN+FDPFSLDIWDPFEGF Sbjct: 1 MALVPSIFGGRRSNIFDPFSLDIWDPFEGF 30 >ref|XP_010426063.1| PREDICTED: 17.6 kDa class I heat shock protein 3-like [Camelina sativa] Length = 155 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MSLIPSIFGGRR NVFDPFSLD+WDPFEGF Sbjct: 1 MSLIPSIFGGRRMNVFDPFSLDVWDPFEGF 30 >ref|XP_010426062.1| PREDICTED: 17.4 kDa class I heat shock protein-like [Camelina sativa] Length = 155 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MS+IPSIFGGRR+NVFDPFSLD+WDPFEGF Sbjct: 1 MSIIPSIFGGRRTNVFDPFSLDVWDPFEGF 30 >ref|XP_010241154.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Nelumbo nucifera] Length = 160 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 91 MSLIPSIFGGRRSNVFDPFSLDIWDPFEGF 2 MS+IPSIFGGRRSN+FDPFSLDIWDPF+GF Sbjct: 1 MSIIPSIFGGRRSNIFDPFSLDIWDPFDGF 30 >gb|KCW52589.1| hypothetical protein EUGRSUZ_J01958 [Eucalyptus grandis] Length = 219 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = -3 Query: 187 DRSFQCIQLSSSEVVEHLTSQSSSTLVKNISEMSLIPSIFGGRRSNVFDPFSLDIWDPFE 8 D S C+ S ++ +++S S N + MSLIPS FGGRRSNVFDPFSLD+W+PF+ Sbjct: 41 DDSNSCL---SPSILSNVSSAQSHIFAGNPTAMSLIPSWFGGRRSNVFDPFSLDLWEPFK 97 Query: 7 GF 2 F Sbjct: 98 DF 99