BLASTX nr result
ID: Gardenia21_contig00015120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00015120 (253 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05183.1| unnamed protein product [Coffea canephora] 76 1e-11 emb|CDP08821.1| unnamed protein product [Coffea canephora] 76 1e-11 ref|XP_010671859.1| PREDICTED: 60S ribosomal protein L36-2-like ... 75 1e-11 ref|XP_010696542.1| PREDICTED: 60S ribosomal protein L36-2-like ... 75 1e-11 ref|XP_010108352.1| 60S ribosomal protein L36-2 [Morus notabilis... 75 2e-11 ref|XP_007051819.1| Ribosomal protein L36e family protein isofor... 75 2e-11 ref|XP_007051818.1| Ribosomal protein L36e family protein isofor... 75 2e-11 ref|XP_007051817.1| 60S ribosomal protein L36 isoform 1 [Theobro... 75 2e-11 pir||T14304 ribosomal protein - carrot (fragment) gi|1276967|gb|... 74 3e-11 sp|P52866.2|RL36_DAUCA RecName: Full=60S ribosomal protein L36 [... 74 3e-11 ref|XP_011008474.1| PREDICTED: 60S ribosomal protein L36-2-like ... 74 3e-11 ref|XP_011008473.1| PREDICTED: 60S ribosomal protein L36-1-like ... 74 3e-11 ref|XP_011045936.1| PREDICTED: 60S ribosomal protein L36-2-like ... 74 3e-11 ref|XP_011045934.1| PREDICTED: 60S ribosomal protein L36-2-like ... 74 3e-11 ref|XP_002317423.1| hypothetical protein POPTR_0011s07390g [Popu... 74 3e-11 ref|XP_004140771.1| PREDICTED: 60S ribosomal protein L36-2-like ... 74 3e-11 ref|XP_002305746.1| 60S ribosomal protein L36-3 [Populus trichoc... 74 3e-11 ref|XP_010108357.1| 60S ribosomal protein L36-2 [Morus notabilis... 74 6e-11 ref|XP_012083401.1| PREDICTED: 60S ribosomal protein L36-2-like ... 74 6e-11 ref|XP_002318214.1| hypothetical protein POPTR_0012s13060g [Popu... 74 6e-11 >emb|CDP05183.1| unnamed protein product [Coffea canephora] Length = 110 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 35 >emb|CDP08821.1| unnamed protein product [Coffea canephora] Length = 110 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 35 >ref|XP_010671859.1| PREDICTED: 60S ribosomal protein L36-2-like [Beta vulgaris subsp. vulgaris] gi|870865306|gb|KMT16373.1| hypothetical protein BVRB_3g055180 [Beta vulgaris subsp. vulgaris] Length = 110 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLNRGH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNRGHIVTKKELAPRPSDRKGK 35 >ref|XP_010696542.1| PREDICTED: 60S ribosomal protein L36-2-like [Beta vulgaris subsp. vulgaris] gi|870868102|gb|KMT18971.1| hypothetical protein BVRB_2g030690 [Beta vulgaris subsp. vulgaris] Length = 110 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLNRGH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNRGHIVTKKELAPRPSDRKGK 35 >ref|XP_010108352.1| 60S ribosomal protein L36-2 [Morus notabilis] gi|587932071|gb|EXC19143.1| 60S ribosomal protein L36-2 [Morus notabilis] Length = 110 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGK 35 >ref|XP_007051819.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma cacao] gi|508704080|gb|EOX95976.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma cacao] Length = 125 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAPRPSDRKGK Sbjct: 25 MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGK 59 >ref|XP_007051818.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma cacao] gi|508704079|gb|EOX95975.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma cacao] Length = 131 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAPRPSDRKGK Sbjct: 24 MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGK 58 >ref|XP_007051817.1| 60S ribosomal protein L36 isoform 1 [Theobroma cacao] gi|508704078|gb|EOX95974.1| 60S ribosomal protein L36 isoform 1 [Theobroma cacao] Length = 110 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGK 35 >pir||T14304 ribosomal protein - carrot (fragment) gi|1276967|gb|AAB01095.1| putative ribosomal protein, partial [Daucus carota] Length = 111 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 6 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 40 >sp|P52866.2|RL36_DAUCA RecName: Full=60S ribosomal protein L36 [Daucus carota] Length = 106 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_011008474.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Populus euphratica] Length = 110 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_011008473.1| PREDICTED: 60S ribosomal protein L36-1-like isoform X1 [Populus euphratica] Length = 112 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_011045936.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Populus euphratica] Length = 110 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_011045934.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Populus euphratica] Length = 117 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 8 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 42 >ref|XP_002317423.1| hypothetical protein POPTR_0011s07390g [Populus trichocarpa] gi|222860488|gb|EEE98035.1| hypothetical protein POPTR_0011s07390g [Populus trichocarpa] Length = 110 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_004140771.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus] gi|449469345|ref|XP_004152381.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis sativus] gi|659073305|ref|XP_008436991.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis melo] gi|659077530|ref|XP_008439254.1| PREDICTED: 60S ribosomal protein L36-2-like [Cucumis melo] gi|307136494|gb|ADN34294.1| 60S ribosomal protein l36e [Cucumis melo subsp. melo] gi|700195120|gb|KGN50297.1| hypothetical protein Csa_5G166410 [Cucumis sativus] gi|700202255|gb|KGN57388.1| hypothetical protein Csa_3G182240 [Cucumis sativus] Length = 110 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_002305746.1| 60S ribosomal protein L36-3 [Populus trichocarpa] gi|118484529|gb|ABK94139.1| unknown [Populus trichocarpa] gi|118487398|gb|ABK95527.1| unknown [Populus trichocarpa] gi|222848710|gb|EEE86257.1| 60S ribosomal protein L36-3 [Populus trichocarpa] Length = 110 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GH+VTKKELAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGK 35 >ref|XP_010108357.1| 60S ribosomal protein L36-2 [Morus notabilis] gi|587932076|gb|EXC19148.1| 60S ribosomal protein L36-2 [Morus notabilis] Length = 178 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAP+PSDRKGK Sbjct: 69 MAPKQPNTGLFVGLNKGHVVTKKELAPKPSDRKGK 103 >ref|XP_012083401.1| PREDICTED: 60S ribosomal protein L36-2-like [Jatropha curcas] gi|643717008|gb|KDP28634.1| hypothetical protein JCGZ_14405 [Jatropha curcas] Length = 110 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKKELAPRPSDRKG+ Sbjct: 1 MAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRKGR 35 >ref|XP_002318214.1| hypothetical protein POPTR_0012s13060g [Populus trichocarpa] gi|743857248|ref|XP_011030131.1| PREDICTED: 60S ribosomal protein L36-2-like [Populus euphratica] gi|118484769|gb|ABK94253.1| unknown [Populus trichocarpa] gi|222858887|gb|EEE96434.1| hypothetical protein POPTR_0012s13060g [Populus trichocarpa] Length = 110 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 106 MAPKQPNTGLFVGLNRGHVVTKKELAPRPSDRKGK 2 MAPKQPNTGLFVGLN+GHVVTKK+LAPRPSDRKGK Sbjct: 1 MAPKQPNTGLFVGLNKGHVVTKKDLAPRPSDRKGK 35