BLASTX nr result
ID: Gardenia21_contig00014639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00014639 (557 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13883.1| unnamed protein product [Coffea canephora] 182 1e-43 ref|XP_009607536.1| PREDICTED: thioredoxin H4-1-like [Nicotiana ... 144 4e-32 ref|XP_009760475.1| PREDICTED: thioredoxin H4-1-like [Nicotiana ... 143 5e-32 ref|XP_012858282.1| PREDICTED: thioredoxin H4-1 [Erythranthe gut... 142 1e-31 ref|XP_006367443.1| PREDICTED: uncharacterized protein LOC102589... 142 1e-31 ref|XP_004235220.1| PREDICTED: thioredoxin H4-1 [Solanum lycoper... 137 3e-30 gb|AHW40458.1| thioredoxin h protein [Nicotiana benthamiana] 136 6e-30 ref|XP_010252021.1| PREDICTED: thioredoxin H4-1 [Nelumbo nucifer... 136 8e-30 ref|XP_002309192.1| thioredoxin family protein [Populus trichoca... 136 8e-30 ref|XP_011018978.1| PREDICTED: thioredoxin H-type-like [Populus ... 135 1e-29 ref|XP_010525423.1| PREDICTED: putative thioredoxin H10 isoform ... 133 5e-29 ref|XP_009608378.1| PREDICTED: thioredoxin H9-like [Nicotiana to... 132 8e-29 ref|XP_002528706.1| Thioredoxin H-type, putative [Ricinus commun... 132 8e-29 ref|XP_009777864.1| PREDICTED: thioredoxin H9-like [Nicotiana sy... 132 8e-29 ref|XP_011076567.1| PREDICTED: thioredoxin H-type-like [Sesamum ... 132 1e-28 ref|XP_010036016.1| PREDICTED: thioredoxin H-type isoform X2 [Eu... 132 1e-28 ref|XP_010036014.1| PREDICTED: thioredoxin H-type isoform X1 [Eu... 132 1e-28 ref|XP_009412647.1| PREDICTED: thioredoxin H4-1-like [Musa acumi... 132 1e-28 gb|EPS73123.1| thioredoxin h-like protein, partial [Genlisea aurea] 132 1e-28 ref|XP_010244548.1| PREDICTED: thioredoxin H9-like [Nelumbo nuci... 131 2e-28 >emb|CDP13883.1| unnamed protein product [Coffea canephora] Length = 137 Score = 182 bits (461), Expect = 1e-43 Identities = 88/101 (87%), Positives = 93/101 (92%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 S+AN+ GKIVVVNFSASW NPCRSIAPAYNELADKY FMLFLTVDVDELAEL N WE+KA Sbjct: 37 SDANRDGKIVVVNFSASWSNPCRSIAPAYNELADKYPFMLFLTVDVDELAELSNSWEIKA 96 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCSDLTTP 255 TPTIFFLRDGK+VDKLVG NKQDLQKK MA+AESCSD TTP Sbjct: 97 TPTIFFLRDGKMVDKLVGDNKQDLQKKTMAVAESCSDRTTP 137 >ref|XP_009607536.1| PREDICTED: thioredoxin H4-1-like [Nicotiana tomentosiformis] gi|697107410|ref|XP_009607537.1| PREDICTED: thioredoxin H4-1-like [Nicotiana tomentosiformis] Length = 139 Score = 144 bits (362), Expect = 4e-32 Identities = 69/98 (70%), Positives = 79/98 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA+ GKI+VVNFSASWCNPCR+ APAY+ELADKY ++FLTVDVDELAEL W++KA Sbjct: 41 SEASDSGKIMVVNFSASWCNPCRTAAPAYHELADKYTSIIFLTVDVDELAELSTSWDIKA 100 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCSDL 264 TPT F RDG+ VDKLVG NKQ+LQKK IAES L Sbjct: 101 TPTFIFFRDGRQVDKLVGGNKQELQKKTANIAESTRSL 138 >ref|XP_009760475.1| PREDICTED: thioredoxin H4-1-like [Nicotiana sylvestris] gi|698440704|ref|XP_009760480.1| PREDICTED: thioredoxin H4-1-like [Nicotiana sylvestris] Length = 139 Score = 143 bits (361), Expect = 5e-32 Identities = 68/94 (72%), Positives = 78/94 (82%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA+ GKI+VVNFSASWCNPCR+ APAY+ELADKY ++FLTVDVDELAEL W++KA Sbjct: 41 SEASNSGKIMVVNFSASWCNPCRTAAPAYHELADKYTSIIFLTVDVDELAELSTSWDIKA 100 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT F RDG+ VDKLVG NKQ+LQKK IAES Sbjct: 101 TPTFIFFRDGRQVDKLVGGNKQELQKKTANIAES 134 >ref|XP_012858282.1| PREDICTED: thioredoxin H4-1 [Erythranthe guttatus] gi|604300292|gb|EYU20135.1| hypothetical protein MIMGU_mgv1a015748mg [Erythranthe guttata] Length = 147 Score = 142 bits (358), Expect = 1e-31 Identities = 68/94 (72%), Positives = 79/94 (84%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA K GKIVVVNFSASWC+PCR I AY+ELADKY MLFLTVDVD+LAE N W++KA Sbjct: 52 SEAYKDGKIVVVNFSASWCSPCRQITTAYSELADKYPAMLFLTVDVDDLAEFSNSWDIKA 111 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT +FLR+G+ +DKLVGANK +L KK MAI+ES Sbjct: 112 TPTFYFLREGRQLDKLVGANKLELHKKTMAISES 145 >ref|XP_006367443.1| PREDICTED: uncharacterized protein LOC102589334 [Solanum tuberosum] Length = 281 Score = 142 bits (357), Expect = 1e-31 Identities = 67/94 (71%), Positives = 76/94 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEAN GKI VVNFSASWCNPCR+ AP Y+ELADKY M+FLTVDVDELAEL W++KA Sbjct: 183 SEANDSGKIAVVNFSASWCNPCRAAAPGYHELADKYTSMIFLTVDVDELAELSTSWDIKA 242 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT F RDG+ VDKLVG KQ+LQ+K M +AES Sbjct: 243 TPTFIFFRDGRQVDKLVGVKKQELQQKLMNLAES 276 >ref|XP_004235220.1| PREDICTED: thioredoxin H4-1 [Solanum lycopersicum] Length = 139 Score = 137 bits (345), Expect = 3e-30 Identities = 65/94 (69%), Positives = 74/94 (78%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEAN GKI VVNFSASWCNPCR+ AP Y+ELADKY M+FLTVDVDEL EL W++KA Sbjct: 41 SEANHTGKIAVVNFSASWCNPCRAAAPGYHELADKYTSMIFLTVDVDELPELSTSWDIKA 100 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT F RDG+ VDKLVG Q+LQ+K M +AES Sbjct: 101 TPTFIFFRDGRQVDKLVGVKNQELQQKLMNLAES 134 >gb|AHW40458.1| thioredoxin h protein [Nicotiana benthamiana] Length = 139 Score = 136 bits (343), Expect = 6e-30 Identities = 66/94 (70%), Positives = 76/94 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA+ KI+VVNFSASWCNPCR+ A AY+ELADKY ++FLTVDVDELAEL W++KA Sbjct: 41 SEASNSDKIMVVNFSASWCNPCRTAALAYHELADKYTSIIFLTVDVDELAELSTSWDIKA 100 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT F RDG+ VDKLVG NKQ+LQKK IAES Sbjct: 101 TPTFIFFRDGRQVDKLVGGNKQELQKKTENIAES 134 >ref|XP_010252021.1| PREDICTED: thioredoxin H4-1 [Nelumbo nucifera] gi|719987452|ref|XP_010252023.1| PREDICTED: thioredoxin H4-1 [Nelumbo nucifera] gi|719987456|ref|XP_010252024.1| PREDICTED: thioredoxin H4-1 [Nelumbo nucifera] Length = 138 Score = 136 bits (342), Expect = 8e-30 Identities = 64/96 (66%), Positives = 76/96 (79%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EAN+ GKIVV NFSASWC PCR IAP Y EL++KY ++FLTVDVDELAE W+++A Sbjct: 39 AEANRNGKIVVANFSASWCGPCRMIAPLYCELSEKYPSLMFLTVDVDELAEFSASWDIRA 98 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCS 270 TPT FFLRDG+ VDKLVGANK +LQ K IAES + Sbjct: 99 TPTFFFLRDGQQVDKLVGANKPELQSKVTTIAESAT 134 >ref|XP_002309192.1| thioredoxin family protein [Populus trichocarpa] gi|118482588|gb|ABK93214.1| unknown [Populus trichocarpa] gi|222855168|gb|EEE92715.1| thioredoxin family protein [Populus trichocarpa] Length = 139 Score = 136 bits (342), Expect = 8e-30 Identities = 63/94 (67%), Positives = 78/94 (82%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA++ GKIV+ NFSA+WC PC+ IAP YNEL++KY +LFL VDVDEL++L WE+KA Sbjct: 40 SEASRDGKIVLANFSATWCGPCKQIAPFYNELSEKYPSLLFLLVDVDELSDLSTSWEIKA 99 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT FFLRDGK ++KLVGANK +LQKK AIA+S Sbjct: 100 TPTFFFLRDGKQLEKLVGANKPELQKKITAIADS 133 >ref|XP_011018978.1| PREDICTED: thioredoxin H-type-like [Populus euphratica] Length = 139 Score = 135 bits (341), Expect = 1e-29 Identities = 63/94 (67%), Positives = 77/94 (81%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA++ GKIV+ NFSA+WC PCR IAP YNEL++KY +LFL VDVDEL++L WE+KA Sbjct: 40 SEASRDGKIVLANFSATWCGPCRQIAPFYNELSEKYPSLLFLLVDVDELSDLSTSWEIKA 99 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT FFLRDGK ++KLVGANK +LQKK AI +S Sbjct: 100 TPTFFFLRDGKQLEKLVGANKPELQKKITAIVDS 133 >ref|XP_010525423.1| PREDICTED: putative thioredoxin H10 isoform X2 [Tarenaya hassleriana] Length = 162 Score = 133 bits (335), Expect = 5e-29 Identities = 63/93 (67%), Positives = 75/93 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EA+ GKI+V NFSASWC PCR IAP Y ELAD+Y FM+F+TVDV+ELAE N W V+A Sbjct: 64 TEASINGKILVANFSASWCIPCREIAPVYQELADRYPFMIFVTVDVEELAEFSNEWNVEA 123 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAE 279 TPTI FLRDG+ VDKLVGAN +LQKK A+A+ Sbjct: 124 TPTIVFLRDGRQVDKLVGANTVELQKKTAAVAD 156 >ref|XP_009608378.1| PREDICTED: thioredoxin H9-like [Nicotiana tomentosiformis] gi|697109042|ref|XP_009608379.1| PREDICTED: thioredoxin H9-like [Nicotiana tomentosiformis] Length = 152 Score = 132 bits (333), Expect = 8e-29 Identities = 61/94 (64%), Positives = 76/94 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EANK GKIV+ NFSASWC PCR IAP Y EL++KY ++FLTVDVDEL E + W++KA Sbjct: 50 AEANKEGKIVIANFSASWCGPCRMIAPFYCELSEKYLSLMFLTVDVDELTEFSSSWDIKA 109 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT FFL+D + +DKLVGANK +LQKK AIA++ Sbjct: 110 TPTFFFLKDSQQIDKLVGANKPELQKKITAIADT 143 >ref|XP_002528706.1| Thioredoxin H-type, putative [Ricinus communis] gi|223531878|gb|EEF33695.1| Thioredoxin H-type, putative [Ricinus communis] Length = 132 Score = 132 bits (333), Expect = 8e-29 Identities = 59/97 (60%), Positives = 79/97 (81%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEA+K GKIV+ NFSA+WC PCR IAP Y EL++KY ++FL +DVDELA+ + W++KA Sbjct: 33 SEASKDGKIVLANFSATWCGPCRMIAPFYRELSEKYPSIMFLLIDVDELADFSSSWDIKA 92 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCSD 267 TPT FFLRDG+ +DKLVGANK +LQKK +A+ ++ +D Sbjct: 93 TPTFFFLRDGQQLDKLVGANKPELQKKIIAVLDTVTD 129 >ref|XP_009777864.1| PREDICTED: thioredoxin H9-like [Nicotiana sylvestris] gi|698582583|ref|XP_009777865.1| PREDICTED: thioredoxin H9-like [Nicotiana sylvestris] gi|698582586|ref|XP_009777866.1| PREDICTED: thioredoxin H9-like [Nicotiana sylvestris] gi|24637231|gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana tabacum] Length = 152 Score = 132 bits (333), Expect = 8e-29 Identities = 61/94 (64%), Positives = 76/94 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EANK GKIV+ NFSASWC PCR IAP Y EL++KY ++FLTVDVDEL E + W++KA Sbjct: 50 AEANKEGKIVIANFSASWCGPCRMIAPFYCELSEKYLSLMFLTVDVDELTEFSSSWDIKA 109 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 TPT FFL+D + +DKLVGANK +LQKK AIA++ Sbjct: 110 TPTFFFLKDSQQIDKLVGANKPELQKKITAIADT 143 >ref|XP_011076567.1| PREDICTED: thioredoxin H-type-like [Sesamum indicum] Length = 147 Score = 132 bits (332), Expect = 1e-28 Identities = 67/95 (70%), Positives = 75/95 (78%), Gaps = 1/95 (1%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKY-HFMLFLTVDVDELAELCNLWEVK 381 SEANK GK VVVNFSASWC PCR IA AY ELA+KY +LFLTVDVD LAE W++K Sbjct: 46 SEANKDGKTVVVNFSASWCIPCRQIAAAYRELAEKYCSSILFLTVDVDALAEFSTTWDIK 105 Query: 380 ATPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAES 276 ATPT F LRDG+ +DKLVGANK +LQ+K AIAES Sbjct: 106 ATPTFFVLRDGRQLDKLVGANKAELQRKITAIAES 140 >ref|XP_010036016.1| PREDICTED: thioredoxin H-type isoform X2 [Eucalyptus grandis] gi|629081093|gb|KCW47538.1| hypothetical protein EUGRSUZ_K01294 [Eucalyptus grandis] Length = 128 Score = 132 bits (332), Expect = 1e-28 Identities = 60/96 (62%), Positives = 77/96 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEANK GKIV+ NFSA+WC PC+ +AP Y+EL++K+ +LFL VDVDEL E+ W++KA Sbjct: 31 SEANKDGKIVLANFSATWCGPCKMMAPFYSELSEKHSSILFLVVDVDELTEMSTSWDIKA 90 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCS 270 TPT FFLRDG+ +DKLVGANK +LQKK AI +S + Sbjct: 91 TPTFFFLRDGQQIDKLVGANKPELQKKITAILDSAN 126 >ref|XP_010036014.1| PREDICTED: thioredoxin H-type isoform X1 [Eucalyptus grandis] gi|702491704|ref|XP_010036015.1| PREDICTED: thioredoxin H-type isoform X1 [Eucalyptus grandis] gi|629081092|gb|KCW47537.1| hypothetical protein EUGRSUZ_K01294 [Eucalyptus grandis] Length = 137 Score = 132 bits (332), Expect = 1e-28 Identities = 60/96 (62%), Positives = 77/96 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEANK GKIV+ NFSA+WC PC+ +AP Y+EL++K+ +LFL VDVDEL E+ W++KA Sbjct: 40 SEANKDGKIVLANFSATWCGPCKMMAPFYSELSEKHSSILFLVVDVDELTEMSTSWDIKA 99 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCS 270 TPT FFLRDG+ +DKLVGANK +LQKK AI +S + Sbjct: 100 TPTFFFLRDGQQIDKLVGANKPELQKKITAILDSAN 135 >ref|XP_009412647.1| PREDICTED: thioredoxin H4-1-like [Musa acuminata subsp. malaccensis] gi|695049421|ref|XP_009412648.1| PREDICTED: thioredoxin H4-1-like [Musa acuminata subsp. malaccensis] Length = 139 Score = 132 bits (331), Expect = 1e-28 Identities = 56/96 (58%), Positives = 76/96 (79%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 SEANK GKIV+ NFSA WC PCR++AP Y EL++KY ++FL++DVDEL E + W++ A Sbjct: 39 SEANKDGKIVIANFSAGWCGPCRAMAPVYMELSEKYLSLMFLSIDVDELTEFSSSWDIHA 98 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAESCS 270 TPT FL+DG+L+DKL+GAN+ DL+KK + +SCS Sbjct: 99 TPTFLFLKDGQLLDKLIGANRSDLEKKIIMFVDSCS 134 >gb|EPS73123.1| thioredoxin h-like protein, partial [Genlisea aurea] Length = 118 Score = 132 bits (331), Expect = 1e-28 Identities = 61/93 (65%), Positives = 75/93 (80%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EA K GKIV+ NFSA+WC PCR IAP Y EL++KY + +FLTVDVDEL EL W++KA Sbjct: 26 AEAQKHGKIVIANFSATWCGPCRMIAPYYVELSEKYPWAVFLTVDVDELIELSTSWDIKA 85 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAE 279 TPT FFLRDG+ +DKLVGANK +LQKK +AI + Sbjct: 86 TPTFFFLRDGQQIDKLVGANKPELQKKLVAILD 118 >ref|XP_010244548.1| PREDICTED: thioredoxin H9-like [Nelumbo nucifera] gi|720088731|ref|XP_010244549.1| PREDICTED: thioredoxin H9-like [Nelumbo nucifera] Length = 132 Score = 131 bits (330), Expect = 2e-28 Identities = 60/93 (64%), Positives = 78/93 (83%) Frame = -1 Query: 557 SEANKGGKIVVVNFSASWCNPCRSIAPAYNELADKYHFMLFLTVDVDELAELCNLWEVKA 378 +EA+K GKIVVVNFSASWC PC+SIAP Y EL++KY ++FL+VDVDELAE + W+++A Sbjct: 40 TEASKNGKIVVVNFSASWCGPCKSIAPFYCELSEKYPSLMFLSVDVDELAEFSSTWDIRA 99 Query: 377 TPTIFFLRDGKLVDKLVGANKQDLQKKAMAIAE 279 TPT +FLRDG+ VD++VGANK DLQKK + A+ Sbjct: 100 TPTFYFLRDGQQVDQIVGANKSDLQKKIASHAK 132