BLASTX nr result
ID: Gardenia21_contig00013701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00013701 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08499.1| unnamed protein product [Coffea canephora] 70 8e-10 >emb|CDP08499.1| unnamed protein product [Coffea canephora] Length = 234 Score = 69.7 bits (169), Expect = 8e-10 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = -1 Query: 193 ISLSTPLKNLHVKSKSSMNGGKYFPVAVEIDGRIYALSSPLSPSGG-DTVDFSFEVYDPL 17 ISLSTPL+N V+ K M+G KYFP+ EIDGRIY LS PL G D VD FEVY PL Sbjct: 126 ISLSTPLENSRVEIKCPMHGAKYFPLIEEIDGRIYVLSGPLPSYGSLDIVDIGFEVYYPL 185