BLASTX nr result
ID: Gardenia21_contig00013612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00013612 (340 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03602.1| unnamed protein product [Coffea canephora] 81 3e-13 ref|XP_011082634.1| PREDICTED: HUA2-like protein 2 [Sesamum indi... 79 1e-12 ref|XP_009617277.1| PREDICTED: HUA2-like protein 3 [Nicotiana to... 77 5e-12 ref|XP_002533075.1| glutathione peroxidase, putative [Ricinus co... 76 9e-12 ref|XP_006355903.1| PREDICTED: HUA2-like protein 3-like [Solanum... 76 9e-12 ref|XP_006479759.1| PREDICTED: HUA2-like protein 3-like isoform ... 76 1e-11 ref|XP_010038116.1| PREDICTED: HUA2-like protein 3 isoform X2 [E... 75 1e-11 ref|XP_010326533.1| PREDICTED: HUA2-like protein 3 [Solanum lyco... 75 2e-11 ref|XP_010255873.1| PREDICTED: probable glutathione peroxidase 4... 75 2e-11 ref|XP_006444126.1| hypothetical protein CICLE_v10022569mg [Citr... 75 2e-11 ref|XP_011033684.1| PREDICTED: probable glutathione peroxidase 4... 75 3e-11 ref|XP_009778335.1| PREDICTED: probable glutathione peroxidase 4... 74 3e-11 ref|XP_009601150.1| PREDICTED: probable glutathione peroxidase 5... 74 4e-11 ref|XP_002320392.1| GLUTATHIONE PEROXIDASE 4 family protein [Pop... 74 6e-11 gb|KHG26222.1| putative glutathione peroxidase 4 -like protein [... 73 7e-11 gb|AFP87136.1| glutathione peroxidase 3 [Dimocarpus longan] 73 7e-11 gb|AFF18778.1| glutathione peroxidase [Dimocarpus longan] 73 7e-11 ref|XP_009770742.1| PREDICTED: probable glutathione peroxidase 5... 73 1e-10 gb|KNA20499.1| hypothetical protein SOVF_051880 [Spinacia oleracea] 72 1e-10 ref|XP_012473952.1| PREDICTED: probable glutathione peroxidase 4... 72 1e-10 >emb|CDP03602.1| unnamed protein product [Coffea canephora] Length = 170 Score = 81.3 bits (199), Expect = 3e-13 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MGSAPSVPQ SIHEFTVKDSKGKDVDLS YKGKVLLVVNVASK Sbjct: 1 MGSAPSVPQTSIHEFTVKDSKGKDVDLSNYKGKVLLVVNVASK 43 >ref|XP_011082634.1| PREDICTED: HUA2-like protein 2 [Sesamum indicum] Length = 1651 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -3 Query: 188 KYSLSHPKREYAGSNFPAEMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVA 9 K SL +R+ + +MG++PSVPQ SIHEFTVKDSKG+DVDLS YKGKVLLVVNVA Sbjct: 1465 KVSLDFRRRKK--EKYGEKMGASPSVPQKSIHEFTVKDSKGRDVDLSTYKGKVLLVVNVA 1522 Query: 8 SK 3 SK Sbjct: 1523 SK 1524 >ref|XP_009617277.1| PREDICTED: HUA2-like protein 3 [Nicotiana tomentosiformis] Length = 1648 Score = 77.0 bits (188), Expect = 5e-12 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -3 Query: 161 EYAGSNFPAEMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 E S F +MG++ SVPQ SIHEFTVKD +GKDVDLS+YKGKVLLVVNVASK Sbjct: 1469 EAENSKFMLKMGASKSVPQKSIHEFTVKDIRGKDVDLSMYKGKVLLVVNVASK 1521 >ref|XP_002533075.1| glutathione peroxidase, putative [Ricinus communis] gi|223527139|gb|EEF29314.1| glutathione peroxidase, putative [Ricinus communis] Length = 1558 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -3 Query: 134 EMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 +MG++PSVP+ SIHEFTVKD++G+DVDLSIYKGKVLLVVNVASK Sbjct: 1389 KMGASPSVPEKSIHEFTVKDARGQDVDLSIYKGKVLLVVNVASK 1432 >ref|XP_006355903.1| PREDICTED: HUA2-like protein 3-like [Solanum tuberosum] Length = 1714 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -3 Query: 134 EMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 +MG++ SVPQ SIHEFTVKDSKGK+VDLSIYKGKVLLVVNVASK Sbjct: 1544 KMGASKSVPQKSIHEFTVKDSKGKNVDLSIYKGKVLLVVNVASK 1587 >ref|XP_006479759.1| PREDICTED: HUA2-like protein 3-like isoform X3 [Citrus sinensis] Length = 1559 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -3 Query: 134 EMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 +MG++ SVPQ SI+EFTVKDSKGKDVDLSIYKGKVLL+VNVASK Sbjct: 1389 QMGASESVPQKSIYEFTVKDSKGKDVDLSIYKGKVLLIVNVASK 1432 >ref|XP_010038116.1| PREDICTED: HUA2-like protein 3 isoform X2 [Eucalyptus grandis] Length = 1583 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 5/61 (8%) Frame = -3 Query: 170 PKREYAGSNFPA-----EMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVAS 6 P R A +FPA +MG++ SVP+ SIHEF VKDS+GKDVDLS YKGKVLLVVNVAS Sbjct: 1396 PFRPPADPHFPASSRSRKMGASQSVPEKSIHEFNVKDSRGKDVDLSTYKGKVLLVVNVAS 1455 Query: 5 K 3 K Sbjct: 1456 K 1456 >ref|XP_010326533.1| PREDICTED: HUA2-like protein 3 [Solanum lycopersicum] Length = 1662 Score = 75.1 bits (183), Expect = 2e-11 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -3 Query: 158 YAGSNFPAEMGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 Y G N +MG++ SVPQ SI+EFTVKDSKGK+VDLSIYKGKVLLVVNVASK Sbjct: 1486 YIGLN--TKMGASKSVPQKSIYEFTVKDSKGKNVDLSIYKGKVLLVVNVASK 1535 >ref|XP_010255873.1| PREDICTED: probable glutathione peroxidase 4 [Nelumbo nucifera] gi|719999937|ref|XP_010255874.1| PREDICTED: probable glutathione peroxidase 4 [Nelumbo nucifera] Length = 170 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ S+PQ SIHEFTV+DS+GKDVDLSIYKGKVLLVVNVASK Sbjct: 1 MGASESIPQKSIHEFTVRDSRGKDVDLSIYKGKVLLVVNVASK 43 >ref|XP_006444126.1| hypothetical protein CICLE_v10022569mg [Citrus clementina] gi|557546388|gb|ESR57366.1| hypothetical protein CICLE_v10022569mg [Citrus clementina] gi|641849920|gb|KDO68794.1| hypothetical protein CISIN_1g030845mg [Citrus sinensis] Length = 170 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SI+EFTVKDSKGKDVDLSIYKGKVLL+VNVASK Sbjct: 1 MGASESVPQKSIYEFTVKDSKGKDVDLSIYKGKVLLIVNVASK 43 >ref|XP_011033684.1| PREDICTED: probable glutathione peroxidase 4 [Populus euphratica] gi|827092219|gb|AKJ66818.1| glutathione peroxidase [Populus euphratica] Length = 170 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MGS+PSVP+ SIHEFTVKDS+G+DV+L IYKGKVLLVVNVASK Sbjct: 1 MGSSPSVPEKSIHEFTVKDSRGQDVNLGIYKGKVLLVVNVASK 43 >ref|XP_009778335.1| PREDICTED: probable glutathione peroxidase 4 [Nicotiana sylvestris] Length = 170 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SIHEFTVKD KGKDVDLS+YKGKVLLVVNVASK Sbjct: 1 MGASKSVPQKSIHEFTVKDIKGKDVDLSMYKGKVLLVVNVASK 43 >ref|XP_009601150.1| PREDICTED: probable glutathione peroxidase 5 [Nicotiana tomentosiformis] Length = 170 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SIHEFTVKD KGKDVDLSIY GKVLLVVNVASK Sbjct: 1 MGASSSVPQKSIHEFTVKDCKGKDVDLSIYNGKVLLVVNVASK 43 >ref|XP_002320392.1| GLUTATHIONE PEROXIDASE 4 family protein [Populus trichocarpa] gi|118486719|gb|ABK95195.1| unknown [Populus trichocarpa] gi|222861165|gb|EEE98707.1| GLUTATHIONE PEROXIDASE 4 family protein [Populus trichocarpa] Length = 170 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MGS+PSVP+ SIHEFTVKD++G+DV+L IYKGKVLLVVNVASK Sbjct: 1 MGSSPSVPEKSIHEFTVKDNRGQDVNLGIYKGKVLLVVNVASK 43 >gb|KHG26222.1| putative glutathione peroxidase 4 -like protein [Gossypium arboreum] Length = 171 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SIHEFTVK+SKG+DVDLS+YKGKVLLVVNVASK Sbjct: 1 MGASESVPQKSIHEFTVKNSKGQDVDLSMYKGKVLLVVNVASK 43 >gb|AFP87136.1| glutathione peroxidase 3 [Dimocarpus longan] Length = 171 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG+A SVP+ SIHEF VKDS+GKDVDLSIY+GKVLLVVNVASK Sbjct: 1 MGAAESVPEKSIHEFIVKDSRGKDVDLSIYRGKVLLVVNVASK 43 >gb|AFF18778.1| glutathione peroxidase [Dimocarpus longan] Length = 171 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG+A SVP+ SIHEF VKDS+GKDVDLSIY+GKVLLVVNVASK Sbjct: 1 MGAAESVPEKSIHEFIVKDSRGKDVDLSIYRGKVLLVVNVASK 43 >ref|XP_009770742.1| PREDICTED: probable glutathione peroxidase 5 [Nicotiana sylvestris] Length = 109 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SIHEFTVKD KGKDVDL+IY GKVLLVVNVASK Sbjct: 1 MGASSSVPQNSIHEFTVKDCKGKDVDLNIYNGKVLLVVNVASK 43 >gb|KNA20499.1| hypothetical protein SOVF_051880 [Spinacia oleracea] Length = 171 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG+ SVPQ SIHEFTVKD++GKDVDLS+Y+GKVLLVVNVASK Sbjct: 1 MGAVESVPQQSIHEFTVKDNRGKDVDLSMYEGKVLLVVNVASK 43 >ref|XP_012473952.1| PREDICTED: probable glutathione peroxidase 4 [Gossypium raimondii] gi|763755809|gb|KJB23140.1| hypothetical protein B456_004G083200 [Gossypium raimondii] Length = 171 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 131 MGSAPSVPQISIHEFTVKDSKGKDVDLSIYKGKVLLVVNVASK 3 MG++ SVPQ SIHEFTVK+SKG+DVDLS YKGKVLLVVNVASK Sbjct: 1 MGASESVPQKSIHEFTVKNSKGQDVDLSTYKGKVLLVVNVASK 43