BLASTX nr result
ID: Gardenia21_contig00013339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00013339 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078823.1| PREDICTED: nudix hydrolase 23, chloroplastic... 114 4e-23 emb|CDP10140.1| unnamed protein product [Coffea canephora] 114 4e-23 ref|XP_009804475.1| PREDICTED: nudix hydrolase 23, chloroplastic... 112 1e-22 ref|XP_009804473.1| PREDICTED: nudix hydrolase 23, chloroplastic... 112 1e-22 ref|XP_009592852.1| PREDICTED: nudix hydrolase 23, chloroplastic... 112 1e-22 ref|XP_012857482.1| PREDICTED: nudix hydrolase 23, chloroplastic... 109 7e-22 ref|XP_006349577.1| PREDICTED: nudix hydrolase 23, chloroplastic... 107 3e-21 ref|XP_006349576.1| PREDICTED: nudix hydrolase 23, chloroplastic... 107 3e-21 ref|XP_010317898.1| PREDICTED: nudix hydrolase 23, chloroplastic... 106 8e-21 ref|XP_010317897.1| PREDICTED: nudix hydrolase 23, chloroplastic... 106 8e-21 ref|XP_010317896.1| PREDICTED: nudix hydrolase 23, chloroplastic... 106 8e-21 ref|XP_004234808.1| PREDICTED: nudix hydrolase 23, chloroplastic... 106 8e-21 ref|XP_010265931.1| PREDICTED: nudix hydrolase 23, chloroplastic... 104 2e-20 gb|KMT15304.1| hypothetical protein BVRB_3g060130 [Beta vulgaris... 100 4e-19 ref|XP_010672643.1| PREDICTED: nudix hydrolase 23, chloroplastic... 100 4e-19 ref|XP_008240926.1| PREDICTED: nudix hydrolase 23, chloroplastic... 100 7e-19 gb|KNA09647.1| hypothetical protein SOVF_151660 [Spinacia oleracea] 99 1e-18 ref|XP_003625267.2| nudix hydrolase-like protein [Medicago trunc... 99 1e-18 ref|XP_007202966.1| hypothetical protein PRUPE_ppa018345mg [Prun... 99 1e-18 gb|AFK41009.1| unknown [Medicago truncatula] 99 1e-18 >ref|XP_011078823.1| PREDICTED: nudix hydrolase 23, chloroplastic [Sesamum indicum] Length = 295 Score = 114 bits (284), Expect = 4e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMK 141 DIPFDSLAFSSMLVTLKLY ED++VGRPKFHYGIINKRPGTSPSEIHAYTLDHH+K Sbjct: 239 DIPFDSLAFSSMLVTLKLYFEDKKVGRPKFHYGIINKRPGTSPSEIHAYTLDHHLK 294 >emb|CDP10140.1| unnamed protein product [Coffea canephora] Length = 318 Score = 114 bits (284), Expect = 4e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLVTLKLYIEDRQVG+PKFHYGIINKRPGTSPSEI+AYTLD HMKS Sbjct: 262 DIPFDSLAFSSMLVTLKLYIEDRQVGKPKFHYGIINKRPGTSPSEIYAYTLDDHMKS 318 >ref|XP_009804475.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X2 [Nicotiana sylvestris] Length = 271 Score = 112 bits (280), Expect = 1e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLVTLKLYIED +VGRPKFHYGIINKRPGTSPSEIHAYTLD+HM+S Sbjct: 215 DIPFDSLAFSSMLVTLKLYIEDIKVGRPKFHYGIINKRPGTSPSEIHAYTLDYHMQS 271 >ref|XP_009804473.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X1 [Nicotiana sylvestris] gi|698519218|ref|XP_009804474.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X1 [Nicotiana sylvestris] Length = 289 Score = 112 bits (280), Expect = 1e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLVTLKLYIED +VGRPKFHYGIINKRPGTSPSEIHAYTLD+HM+S Sbjct: 233 DIPFDSLAFSSMLVTLKLYIEDIKVGRPKFHYGIINKRPGTSPSEIHAYTLDYHMQS 289 >ref|XP_009592852.1| PREDICTED: nudix hydrolase 23, chloroplastic [Nicotiana tomentosiformis] Length = 227 Score = 112 bits (280), Expect = 1e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLVTLKLYIED +VGRPKFHYGIINKRPGTSPSEIHAYTLD+HM+S Sbjct: 171 DIPFDSLAFSSMLVTLKLYIEDIKVGRPKFHYGIINKRPGTSPSEIHAYTLDYHMQS 227 >ref|XP_012857482.1| PREDICTED: nudix hydrolase 23, chloroplastic [Erythranthe guttatus] gi|604300973|gb|EYU20693.1| hypothetical protein MIMGU_mgv1a010919mg [Erythranthe guttata] Length = 297 Score = 109 bits (273), Expect = 7e-22 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMK 141 DIPFDSLAFSSMLVTLKLY+ED +VGRPKFHYGIINKRPGTSPS+I AYTLDHHMK Sbjct: 241 DIPFDSLAFSSMLVTLKLYLEDIKVGRPKFHYGIINKRPGTSPSDIRAYTLDHHMK 296 >ref|XP_006349577.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 281 Score = 107 bits (268), Expect = 3e-21 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIP+DSLAFSSMLVTL LYIED +VGRPKFHYG+INKRPGTSPSEIHAYTLD HM+S Sbjct: 225 DIPYDSLAFSSMLVTLNLYIEDIKVGRPKFHYGVINKRPGTSPSEIHAYTLDFHMQS 281 >ref|XP_006349576.1| PREDICTED: nudix hydrolase 23, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 284 Score = 107 bits (268), Expect = 3e-21 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIP+DSLAFSSMLVTL LYIED +VGRPKFHYG+INKRPGTSPSEIHAYTLD HM+S Sbjct: 228 DIPYDSLAFSSMLVTLNLYIEDIKVGRPKFHYGVINKRPGTSPSEIHAYTLDFHMQS 284 >ref|XP_010317898.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X4 [Solanum lycopersicum] Length = 263 Score = 106 bits (264), Expect = 8e-21 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLV+L LYIED +VGRPKFHYG+INKRPGTSPS+IHAYTLD HM+S Sbjct: 207 DIPFDSLAFSSMLVSLNLYIEDIKVGRPKFHYGVINKRPGTSPSDIHAYTLDFHMQS 263 >ref|XP_010317897.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X3 [Solanum lycopersicum] Length = 266 Score = 106 bits (264), Expect = 8e-21 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLV+L LYIED +VGRPKFHYG+INKRPGTSPS+IHAYTLD HM+S Sbjct: 210 DIPFDSLAFSSMLVSLNLYIEDIKVGRPKFHYGVINKRPGTSPSDIHAYTLDFHMQS 266 >ref|XP_010317896.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X1 [Solanum lycopersicum] Length = 284 Score = 106 bits (264), Expect = 8e-21 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLV+L LYIED +VGRPKFHYG+INKRPGTSPS+IHAYTLD HM+S Sbjct: 228 DIPFDSLAFSSMLVSLNLYIEDIKVGRPKFHYGVINKRPGTSPSDIHAYTLDFHMQS 284 >ref|XP_004234808.1| PREDICTED: nudix hydrolase 23, chloroplastic isoform X2 [Solanum lycopersicum] Length = 281 Score = 106 bits (264), Expect = 8e-21 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLV+L LYIED +VGRPKFHYG+INKRPGTSPS+IHAYTLD HM+S Sbjct: 225 DIPFDSLAFSSMLVSLNLYIEDIKVGRPKFHYGVINKRPGTSPSDIHAYTLDFHMQS 281 >ref|XP_010265931.1| PREDICTED: nudix hydrolase 23, chloroplastic [Nelumbo nucifera] gi|720031829|ref|XP_010265932.1| PREDICTED: nudix hydrolase 23, chloroplastic [Nelumbo nucifera] gi|720031832|ref|XP_010265933.1| PREDICTED: nudix hydrolase 23, chloroplastic [Nelumbo nucifera] Length = 293 Score = 104 bits (260), Expect = 2e-20 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSMLVTL +YIED + G+PKFHYGIINKRPGT P +IHAYTLDHHM+S Sbjct: 237 DIPFDSLAFSSMLVTLNMYIEDIKTGKPKFHYGIINKRPGTRPDDIHAYTLDHHMQS 293 >gb|KMT15304.1| hypothetical protein BVRB_3g060130 [Beta vulgaris subsp. vulgaris] Length = 276 Score = 100 bits (249), Expect = 4e-19 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 +IPFDSLAFSSMLVTLKLYIED + G+PKFHYG INKRPGTSPS+IHA++LD+H++S Sbjct: 220 EIPFDSLAFSSMLVTLKLYIEDMKDGKPKFHYGTINKRPGTSPSDIHAFSLDYHLQS 276 >ref|XP_010672643.1| PREDICTED: nudix hydrolase 23, chloroplastic [Beta vulgaris subsp. vulgaris] Length = 282 Score = 100 bits (249), Expect = 4e-19 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 +IPFDSLAFSSMLVTLKLYIED + G+PKFHYG INKRPGTSPS+IHA++LD+H++S Sbjct: 226 EIPFDSLAFSSMLVTLKLYIEDMKDGKPKFHYGTINKRPGTSPSDIHAFSLDYHLQS 282 >ref|XP_008240926.1| PREDICTED: nudix hydrolase 23, chloroplastic [Prunus mume] Length = 299 Score = 99.8 bits (247), Expect = 7e-19 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSM+VTLKLY ED + G+ KFHYGIINK+PGTSPS+IHAYTLD+H++S Sbjct: 243 DIPFDSLAFSSMVVTLKLYAEDAKAGQLKFHYGIINKKPGTSPSDIHAYTLDYHLQS 299 >gb|KNA09647.1| hypothetical protein SOVF_151660 [Spinacia oleracea] Length = 271 Score = 99.4 bits (246), Expect = 1e-18 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 +IPFDSLAFSSMLVTLKLYIED + G+PKFHYG I+KRPGTSPS+IHA TLD+H++S Sbjct: 215 EIPFDSLAFSSMLVTLKLYIEDMRAGKPKFHYGTISKRPGTSPSDIHASTLDYHLQS 271 >ref|XP_003625267.2| nudix hydrolase-like protein [Medicago truncatula] gi|657379284|gb|AES81485.2| nudix hydrolase-like protein [Medicago truncatula] Length = 268 Score = 99.4 bits (246), Expect = 1e-18 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHM 144 DIPF+SL+FSSM+VTL LYIED + G+PKFHYG INKRPGTSPS+ HAYTLDHHM Sbjct: 212 DIPFNSLSFSSMVVTLSLYIEDMKAGKPKFHYGTINKRPGTSPSDSHAYTLDHHM 266 >ref|XP_007202966.1| hypothetical protein PRUPE_ppa018345mg [Prunus persica] gi|462398497|gb|EMJ04165.1| hypothetical protein PRUPE_ppa018345mg [Prunus persica] Length = 300 Score = 99.4 bits (246), Expect = 1e-18 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHMKS 138 DIPFDSLAFSSM+VTLKLY ED + G+ KFHYGIINK+PGTSPS+IHAYTLD+H++S Sbjct: 244 DIPFDSLAFSSMVVTLKLYAEDVRAGKLKFHYGIINKKPGTSPSDIHAYTLDYHLQS 300 >gb|AFK41009.1| unknown [Medicago truncatula] Length = 118 Score = 99.4 bits (246), Expect = 1e-18 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -1 Query: 308 DIPFDSLAFSSMLVTLKLYIEDRQVGRPKFHYGIINKRPGTSPSEIHAYTLDHHM 144 DIPF+SL+FSSM+VTL LYIED + G+PKFHYG INKRPGTSPS+ HAYTLDHHM Sbjct: 62 DIPFNSLSFSSMVVTLSLYIEDMKAGKPKFHYGTINKRPGTSPSDSHAYTLDHHM 116