BLASTX nr result
ID: Gardenia21_contig00012985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012985 (589 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97647.1| unnamed protein product [Coffea canephora] 68 4e-09 >emb|CDO97647.1| unnamed protein product [Coffea canephora] Length = 1496 Score = 67.8 bits (164), Expect = 4e-09 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 194 IFQICYYKLLIKVLIVAVQKGKCEVREKEDLNSVPTN-VFQHTFFC*EQYDPLSEAYLK 21 I +I Y + +IKV +VAV KGKCEVREKEDLN +PT VFQH FFC + YDP+S A K Sbjct: 915 IREIYYSEQVIKVPVVAV-KGKCEVREKEDLNPIPTTYVFQHIFFCEQLYDPISGALQK 972