BLASTX nr result
ID: Gardenia21_contig00012915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012915 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14369.1| unnamed protein product [Coffea canephora] 73 1e-10 >emb|CDP14369.1| unnamed protein product [Coffea canephora] Length = 347 Score = 72.8 bits (177), Expect = 1e-10 Identities = 36/62 (58%), Positives = 40/62 (64%) Frame = +3 Query: 48 VLSDIRKLKYKFDKCCFSFTKRENNYVSHRLAKFAVKCLVNVEWKVKFPCWLLESARADS 227 +L DI LK F KCCFSFT+R NN VSH LAK A+ EWKV FP WLLE +AD Sbjct: 280 ILLDIVSLKSNFYKCCFSFTRRMNNSVSHSLAKLALSLDGPAEWKVVFPAWLLELLQADC 339 Query: 228 EG 233 G Sbjct: 340 RG 341