BLASTX nr result
ID: Gardenia21_contig00012741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012741 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07298.1| unnamed protein product [Coffea canephora] 69 2e-09 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 gb|KHN33805.1| Pentatricopeptide repeat-containing protein, mito... 61 3e-07 gb|KHN20117.1| Pentatricopeptide repeat-containing protein, mito... 61 3e-07 ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_010094587.1| hypothetical protein L484_024883 [Morus nota... 61 4e-07 gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [... 60 5e-07 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 60 5e-07 ref|XP_010494168.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010442157.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_014499649.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 gb|KOM51718.1| hypothetical protein LR48_Vigan09g037700 [Vigna a... 60 8e-07 >emb|CDP07298.1| unnamed protein product [Coffea canephora] Length = 735 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLKV 104 VPAVYEEMLS+GCLPDRKAR+MLRSALRYMKS LKV Sbjct: 700 VPAVYEEMLSSGCLPDRKARAMLRSALRYMKSTLKV 735 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum lycopersicum] Length = 699 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLKV 104 VPAVYEEML +GC+PDRKAR+MLRSALRYMKS LK+ Sbjct: 664 VPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum tuberosum] Length = 697 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLKV 104 VPAVYEEML GC+PDRKAR+MLRSALRYMKS LK+ Sbjct: 662 VPAVYEEMLLCGCIPDRKARAMLRSALRYMKSTLKL 697 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Citrus sinensis] Length = 99 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+S+GC PDRKAR+MLRSALRYMK LK Sbjct: 64 VPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 98 >ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 704 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+S+GC PDRKAR+MLRSALRYMK LK Sbjct: 669 VPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_011101111.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Sesamum indicum] Length = 689 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLKV 104 VPAV+EEML +GC PDRKAR+MLRSALRYMKS LK+ Sbjct: 654 VPAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 689 >ref|XP_009784787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] gi|698474688|ref|XP_009784788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] Length = 710 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEML +GC PDRKAR+MLRSALRY+KS LK Sbjct: 676 VPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >ref|XP_009606848.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] gi|697106032|ref|XP_009606849.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 710 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEML +GC PDRKAR+MLRSALRY+KS LK Sbjct: 676 VPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >ref|XP_012829544.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Erythranthe guttatus] gi|604297234|gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Erythranthe guttata] Length = 687 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLKV 104 VPAV+EEML +GC PDRKAR+MLRSALRYMKS LK+ Sbjct: 652 VPAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 687 >gb|KHN33805.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 489 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 454 VPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 488 >gb|KHN20117.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 613 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 578 VPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 612 >ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] gi|947103238|gb|KRH51621.1| hypothetical protein GLYMA_06G018300 [Glycine max] gi|947103239|gb|KRH51622.1| hypothetical protein GLYMA_06G018300 [Glycine max] Length = 696 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 661 VPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 695 >ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] gi|947112641|gb|KRH60943.1| hypothetical protein GLYMA_04G018000 [Glycine max] gi|947112642|gb|KRH60944.1| hypothetical protein GLYMA_04G018000 [Glycine max] Length = 680 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 645 VPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 679 >ref|XP_010094587.1| hypothetical protein L484_024883 [Morus notabilis] gi|587866903|gb|EXB56341.1| hypothetical protein L484_024883 [Morus notabilis] Length = 734 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VP VYEEM+S+GC PDRKAR MLRSALRYMK LK Sbjct: 672 VPVVYEEMISSGCTPDRKAREMLRSALRYMKQTLK 706 >gb|KDO85079.1| hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+ +GC PDRKAR+MLRSALRYMK LK Sbjct: 76 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 110 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VPAVYEEM+ +GC PDRKAR+MLRSALRYMK LK Sbjct: 669 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_010494168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Camelina sativa] gi|727647090|ref|XP_010494169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X2 [Camelina sativa] Length = 709 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VP VYEEM+ +GC PDRKARSMLRSALRYMK LK Sbjct: 673 VPGVYEEMIMSGCKPDRKARSMLRSALRYMKQTLK 707 >ref|XP_010442157.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Camelina sativa] Length = 714 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VP VYEEM+ +GC PDRKARSMLRSALRYMK LK Sbjct: 678 VPGVYEEMIMSGCKPDRKARSMLRSALRYMKQTLK 712 >ref|XP_014499649.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Vigna radiata var. radiata] Length = 692 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VP VYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 657 VPGVYEEMVTSGCAPDRKARAMLRSALRYMKQTLK 691 >gb|KOM51718.1| hypothetical protein LR48_Vigan09g037700 [Vigna angularis] Length = 687 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 211 VPAVYEEMLSAGCLPDRKARSMLRSALRYMKSMLK 107 VP VYEEM+++GC PDRKAR+MLRSALRYMK LK Sbjct: 652 VPGVYEEMVTSGCAPDRKARAMLRSALRYMKQTLK 686