BLASTX nr result
ID: Gardenia21_contig00011932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00011932 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07719.1| unnamed protein product [Coffea canephora] 101 2e-19 >emb|CDP07719.1| unnamed protein product [Coffea canephora] Length = 260 Score = 101 bits (252), Expect = 2e-19 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +2 Query: 122 ISSTCIFSPAPNLLQNPSSKLIQTHFSRFNFNSLKPLKTTPLKFTFHSLQTTREQQPTR 298 +SS C+FSPAPNLLQ PSSKLI+THFSR NFN LKPLK TPLKFTFHS QTTREQQPTR Sbjct: 1 MSSACVFSPAPNLLQIPSSKLIKTHFSRLNFNGLKPLK-TPLKFTFHSPQTTREQQPTR 58