BLASTX nr result
ID: Gardenia21_contig00011646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00011646 (666 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98938.1| unnamed protein product [Coffea canephora] 65 4e-08 >emb|CDO98938.1| unnamed protein product [Coffea canephora] Length = 267 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 540 GSISRSASLRNEKYDRPSHQHSSPGGNDHRALVVGHEP 427 GS+SRSAS R+EK+DRPS QHS+PGGNDHR LVV H P Sbjct: 206 GSVSRSASPRDEKHDRPSRQHSTPGGNDHRVLVVDHVP 243