BLASTX nr result
ID: Gardenia21_contig00011582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00011582 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08270.1| unnamed protein product [Coffea canephora] 90 8e-16 >emb|CDP08270.1| unnamed protein product [Coffea canephora] Length = 288 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -1 Query: 161 MAIHDGKEXXXXHNDSSHRPGTHEQKRVCIQNRYGEKLVGILHETGSKGVVII 3 MA+H+GKE HNDSSH+PGTHEQKRV IQNRYGEKLVGILHETGSK VVII Sbjct: 1 MAVHEGKEHHHHHNDSSHQPGTHEQKRVRIQNRYGEKLVGILHETGSKEVVII 53