BLASTX nr result
ID: Gardenia21_contig00011045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00011045 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08074.1| unnamed protein product [Coffea canephora] 110 4e-23 >emb|CDP08074.1| unnamed protein product [Coffea canephora] Length = 363 Score = 110 bits (275), Expect(2) = 4e-23 Identities = 43/64 (67%), Positives = 54/64 (84%) Frame = -1 Query: 194 LHFCMTYVEWRKSGEWSPNVAVEANWMKLAAYLNKEWSKQYAWSVYHSKFMLMKKIWCLY 15 +HFCMTYVEW+KSGEW+PN++ EANWMKLAA+LN W KQY W+VYHSK+ +K+IW + Sbjct: 60 MHFCMTYVEWKKSGEWNPNMSTEANWMKLAAHLNSSWGKQYMWTVYHSKYTRLKRIWRAF 119 Query: 14 VKLK 3 KLK Sbjct: 120 AKLK 123 Score = 24.3 bits (51), Expect(2) = 4e-23 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 241 MSLFLMPRDHSLPKAY 194 ++ F MPRDH+ KAY Sbjct: 38 VNYFKMPRDHTTAKAY 53