BLASTX nr result
ID: Gardenia21_contig00011017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00011017 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidop... 84 5e-14 ref|XP_010453468.1| PREDICTED: 26S protease regulatory subunit 6... 84 5e-14 ref|XP_010244563.1| PREDICTED: 26S protease regulatory subunit 6... 84 5e-14 ref|XP_010252000.1| PREDICTED: 26S protease regulatory subunit 6... 84 5e-14 ref|XP_010045430.1| PREDICTED: 26S protease regulatory subunit 6... 84 5e-14 emb|CDP04036.1| unnamed protein product [Coffea canephora] 84 5e-14 gb|KCW87590.1| hypothetical protein EUGRSUZ_B040321, partial [Eu... 84 5e-14 ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutr... 84 5e-14 gb|ACA61610.1| hypothetical protein AP2_E06.1 [Arabidopsis lyrat... 84 5e-14 ref|XP_013606110.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_010931394.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_009410502.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_013621673.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 emb|CDY32995.1| BnaA10g12010D [Brassica napus] 82 1e-13 ref|XP_013622006.1| PREDICTED: 26S protease regulatory subunit 6... 82 1e-13 >ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|565430379|ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|482548338|gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] Length = 408 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 371 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >ref|XP_010453468.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] gi|727539606|ref|XP_010443548.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] gi|727625123|ref|XP_010483400.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina sativa] Length = 408 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 371 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >ref|XP_010244563.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo nucifera] Length = 421 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 384 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 421 >ref|XP_010252000.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo nucifera] Length = 420 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 383 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 420 >ref|XP_010045430.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Eucalyptus grandis] Length = 414 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 377 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 414 >emb|CDP04036.1| unnamed protein product [Coffea canephora] Length = 326 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 289 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 326 >gb|KCW87590.1| hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] gi|629123101|gb|KCW87591.1| hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] gi|629123102|gb|KCW87592.1| hypothetical protein EUGRSUZ_B040321, partial [Eucalyptus grandis] Length = 44 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 7 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 44 >ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] gi|557102197|gb|ESQ42560.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] Length = 404 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 404 >gb|ACA61610.1| hypothetical protein AP2_E06.1 [Arabidopsis lyrata subsp. petraea] Length = 172 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK Sbjct: 135 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 172 >ref|XP_013606110.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_010931394.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Elaeis guineensis] Length = 418 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF+FYK Sbjct: 381 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 418 >ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 405 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 368 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 405 >ref|XP_009410502.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Musa acuminata subsp. malaccensis] Length = 415 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF+FYK Sbjct: 378 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 415 >ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] gi|923891473|ref|XP_013716802.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_013621673.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] gi|923526256|ref|XP_013683742.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|674930545|emb|CDY02806.1| BnaC02g10830D [Brassica napus] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] gi|923526006|ref|XP_013682928.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica napus] gi|674900274|emb|CDY32714.1| BnaA02g07760D [Brassica napus] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY32995.1| BnaA10g12010D [Brassica napus] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_013622006.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica oleracea var. oleracea] gi|674874656|emb|CDY58566.1| BnaC03g12460D [Brassica napus] Length = 404 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 360 EAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 247 EAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 367 EAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404